Recombinant Full Length Human RANBP1 Protein

• Cat.No.: RANBP1-426HF
• Product Overview: Recombinant full length Human RanBP1 protein with an N terminal proprietary tag; predicted mwt: 49.11 kDa.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 210 amino acids
• Description: Ran/TC4-binding protein, RanBP1, interacts specifically with GTP-charged RAN. RANBP1 encodes a 23-kD protein that binds to RAN complexed with GTP but not GDP. RANBP1 does not activate GTPase activity of RAN but does markedly increase GTP hydrolysis by the RanGTPase-activating protein (RanGAP1). The RANBP1 cDNA encodes a 201-amino acid protein that is 92% similar to its mouse homolog. In both mammalian cells and in yeast, RANBP1 acts as a negative regulator of RCC1 by inhibiting RCC1-stimulated guanine nucleotide release from RAN.
• Form: Liquid
• Molecular Mass: 49.110kDa
• AA Sequence: MAAAKDTHEDHDTSTENTDESNHDPQFEPIVSLPEQEIKT LEEDEEELFKMRAKLFRFASENDLPEWKERGTGDVKLLKH KEKGAIRLLMRRDKTLKICANHYITPMMELKPNAGSDRAW VWNTHADFADECPKPELLAIRFLNAENAQKFKTKFEECRK EIEEREKKAGSGKNDHAEKVAEKLEALSVKEETKEDAEEK Q
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: RANBP1 RAN binding protein 1 [ Homo sapiens ]
• Official Symbol: RANBP1
• Synonyms: RANBP1; RAN binding protein 1; ran-specific GTPase-activating protein; HTF9A
• Gene ID: 5902
• mRNA Refseq: NM_002882
• Protein Refseq: NP_002873
• MIM: 601180
• UniProt ID: P43487