Recombinant Full Length Human RBM4, His-tagged
Cat.No. : | RBM4-31230TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-364 of Human RBM4 with N terminal His tag, 45kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-364 a.a. |
Description : | This gene encodes a protein that contains 2 RRM type RNA binding motifs and a retroviral type zinc finger.RBM4 may play a role in alternative splice site selection during pre mRNA processing.It binds TNPO3, which mediates nuclear import of the protein. This interaction is disrupted by nuclear Ran bound to GTP. RBM4 is ubiquitously expressed. It is expressed in fetal brain and is down regulated in fetal Down syndrome brain. |
Form : | Lyophilised. 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5. |
AA Sequence : | MVKLFIGNLPREATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDKTAAEDAIRNLHHYKLHGVNINVE ASKNKSKTSTKLHVGNISPTCTNKELRAKFEEYGPVIECDIVKDYAFVHMERAEDAVEAIR GLDNTEFQGKRMHVQLSTSRLRTAPGMGDQSGCYRCGKEGHWSKECPIDRSGRVADLTEQY NEQYGAVRTPYTMSYGDSLYYNNAYGALDAYYKRCRAARSYEAVAAAAASVYNYAEQTLSQ LPQVQNTAMASHLTSTSLDPYDRHLLPTSGAAATAAAAAAA AAA VTAASTSYYGRDRSPLRRATAPVPTVGEGYGYGHESELSQASAAA RNSLYDMARYEREQ YADRARYSAF |
Applications : | SDS-PAGE; Mass Spectrometry |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. |
Reconstitution : | Reconstitute with 84 µl aqua dest. |
Full Length : | Full L. |
Gene Name | RBM4 RNA binding motif protein 4 [ Homo sapiens (human) ] |
Official Symbol | RBM4 |
Synonyms | RBM4; LARK; RBM4A; ZCRB3A; ZCCHC21; RP11-658F2.8; RNA binding motif protein 4; RNA-binding protein 4; lark homolog; RNA-binding motif protein 4a; transcriptional coactivator CoAZ; zinc finger CCHC-type and RNA binding motif 3A |
Gene ID | 5936 |
mRNA Refseq | NM_001198843 |
Protein Refseq | NP_001185772 |
MIM | 602571 |
UniProt ID | Q9BWF3 |
Chromosome Location | 11q13 |
Function | RNA binding; mRNA 3'-UTR binding; nucleotide binding |
◆ Recombinant Proteins | ||
RBM4-31230TH | Recombinant Full Length Human RBM4, His-tagged | +Inquiry |
RBM4-430HF | Recombinant Full Length Human RBM4 Protein, GST-tagged | +Inquiry |
RBM4-2490H | Recombinant Human RBM4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Rbm4-5413M | Recombinant Mouse Rbm4 Protein, Myc/DDK-tagged | +Inquiry |
RBM4-847C | Recombinant Cynomolgus RBM4 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RBM4-531HCL | Recombinant Human RBM4 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RBM4 Products
Required fields are marked with *
My Review for All RBM4 Products
Required fields are marked with *