Recombinant Full Length Human RBP1 Protein
| Cat.No. : | RBP1-431HF |
| Product Overview : | Recombinant full length Human RBP1 with N-terminal proprietary tag.Mol Wt 40.92 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 135 amino acids |
| Description : | This gene encodes the carrier protein involved in the transport of retinol (vitamin A alcohol) from the liver storage site to peripheral tissue. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Form : | Liquid |
| Molecular Mass : | 40.920kDa inclusive of tags |
| AA Sequence : | MPVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPD KEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEEDLTGIDD RKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEM RVEGVVCKQVFKKVQ |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | RBP1 retinol binding protein 1, cellular [ Homo sapiens ] |
| Official Symbol | RBP1 |
| Synonyms | RBP1; retinol binding protein 1, cellular; retinol-binding protein 1; CRABP I; CRBP; CRBP1; CRBPI; RBPC |
| Gene ID | 5947 |
| mRNA Refseq | NM_001130992 |
| Protein Refseq | NP_001124464 |
| MIM | 180260 |
| UniProt ID | P09455 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RBP1 Products
Required fields are marked with *
My Review for All RBP1 Products
Required fields are marked with *



