Recombinant Full Length Human RBP1 Protein

• Cat.No.: RBP1-431HF
• Product Overview: Recombinant full length Human RBP1 with N-terminal proprietary tag.Mol Wt 40.92 kDa inclusive of tag.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 135 amino acids
• Description: This gene encodes the carrier protein involved in the transport of retinol (vitamin A alcohol) from the liver storage site to peripheral tissue. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. Multiple transcript variants encoding different isoforms have been found for this gene.
• Form: Liquid
• Molecular Mass: 40.920kDa inclusive of tags
• AA Sequence: MPVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPD KEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEEDLTGIDD RKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEM RVEGVVCKQVFKKVQ
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: RBP1 retinol binding protein 1, cellular [ Homo sapiens ]
• Official Symbol: RBP1
• Synonyms: RBP1; retinol binding protein 1, cellular; retinol-binding protein 1; CRABP I; CRBP; CRBP1; CRBPI; RBPC
• Gene ID: 5947
• mRNA Refseq: NM_001130992
• Protein Refseq: NP_001124464
• MIM: 180260
• UniProt ID: P09455