Recombinant Full Length Human RBP4 Protein, C-Flag-tagged
Cat.No. : | RBP4-1421HFL |
Product Overview : | Recombinant Full Length Human RBP4 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This protein belongs to the lipocalin family and is the specific carrier for retinol (vitamin A alcohol) in the blood. It delivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin which prevents its loss by filtration through the kidney glomeruli. A deficiency of vitamin A blocks secretion of the binding protein posttranslationally and results in defective delivery and supply to the epidermal cells. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 21 kDa |
AA Sequence : | MKWVWALFLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQ MSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRL LNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein |
Full Length : | Full L. |
Gene Name | RBP4 retinol binding protein 4 [ Homo sapiens (human) ] |
Official Symbol | RBP4 |
Synonyms | RDCCAS; MCOPCB10 |
Gene ID | 5950 |
mRNA Refseq | NM_006744.4 |
Protein Refseq | NP_006735.2 |
MIM | 180250 |
UniProt ID | P02753 |
◆ Recombinant Proteins | ||
RBP4-3717H | Recombinant Human RBP4, His-tagged | +Inquiry |
RBP4-836H | Active Recombinant Full Length Human RBP4 protein, His-tagged | +Inquiry |
RBP4-5634C | Recombinant Chicken RBP4 protein, His-tagged | +Inquiry |
RBP4-6158H | Recombinant Human RBP4 Protein (Glu19-Leu201) | +Inquiry |
RBP4-354H | Active Recombinant Human RBP4 Protein (Glu19-Leu201), C-6×His tagged | +Inquiry |
◆ Native Proteins | ||
RBP4-247H | Native Human Retinol Binding Protein 4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
RBP4-2863HCL | Recombinant Human RBP4 cell lysate | +Inquiry |
RBP4-2304MCL | Recombinant Mouse RBP4 cell lysate | +Inquiry |
RBP4-2271RCL | Recombinant Rat RBP4 cell lysate | +Inquiry |
RBP4-1045CCL | Recombinant Cynomolgus RBP4 cell lysate | +Inquiry |
RBP4-1517CCL | Recombinant Canine RBP4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RBP4 Products
Required fields are marked with *
My Review for All RBP4 Products
Required fields are marked with *
0
Inquiry Basket