Recombinant Full Length Human RBP4 protein, His-tagged
| Cat.No. : | RBP4-3489H |
| Product Overview : | Recombinant Human RBP4 protein(1-201 aa), fused to His tag, was expressed in E. coli. |
| Availability | November 17, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-201 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MKWVWALFLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | RBP4 retinol binding protein 4, plasma [ Homo sapiens ] |
| Official Symbol | RBP4 |
| Synonyms | RBP4; retinol binding protein 4, plasma; retinol-binding protein 4; RBP; PRBP; plasma retinol-binding protein; retinol-binding protein 4, interstitial; |
| Gene ID | 5950 |
| mRNA Refseq | NM_006744 |
| Protein Refseq | NP_006735 |
| UniProt ID | P02753 |
| ◆ Recombinant Proteins | ||
| RBP4-112H | Recombinant Human RBP4, His-tagged | +Inquiry |
| RBP4-354H | Active Recombinant Human RBP4 Protein (Glu19-Leu201), C-6×His tagged | +Inquiry |
| RBP4-3975H | Recombinant Human RBP4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RBP4-5634C | Recombinant Chicken RBP4 protein, His-tagged | +Inquiry |
| RBP4-836H | Active Recombinant Full Length Human RBP4 protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| RBP4-247H | Native Human Retinol Binding Protein 4 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RBP4-1045CCL | Recombinant Cynomolgus RBP4 cell lysate | +Inquiry |
| RBP4-2304MCL | Recombinant Mouse RBP4 cell lysate | +Inquiry |
| RBP4-2863HCL | Recombinant Human RBP4 cell lysate | +Inquiry |
| RBP4-2271RCL | Recombinant Rat RBP4 cell lysate | +Inquiry |
| RBP4-1517CCL | Recombinant Canine RBP4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RBP4 Products
Required fields are marked with *
My Review for All RBP4 Products
Required fields are marked with *
