Recombinant Full Length Human RDH10 Protein, C-Flag-tagged
Cat.No. : | RDH10-1789HFL |
Product Overview : | Recombinant Full Length Human RDH10 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a retinol dehydrogenase, which converts all-trans-retinol to all-trans-retinal, with preference for NADP as a cofactor. Studies in mice suggest that this protein is essential for synthesis of embryonic retinoic acid and is required for limb, craniofacial, and organ development. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 37.9 kDa |
AA Sequence : | MNIVVEFFVVTFKVLWAFVLAAARWLVRPKEKSVAGQVCLITGAGSGLGRLFALEFARRRALLVLWDINT QSNEETAGMVRHIYRDLEAADAAALQAGNGEEEILPHCNLQVFTYTCDVGKRENVYLTAERVRKEVGEVS VLVNNAGVVSGHHLLECPDELIERTMMVNCHAHFWTTKAFLPTMLEINHGHIVTVASSLGLFSTAGVEDY CASKFGVVGFHESLSHELKAAEKDGIKTTLVCPYLVDTGMFRGCRIRKEIEPFLPPLKPDYCVKQAMKAI LTDQPMICTPRLMYIVTFMKSILPFEAVVCMYRFLGADKCMYPFIAQRKQATNNNEAKNGI myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Protein Pathways : | Metabolic pathways, Retinol metabolism |
Full Length : | Full L. |
Gene Name | RDH10 retinol dehydrogenase 10 [ Homo sapiens (human) ] |
Official Symbol | RDH10 |
Synonyms | SDR16C4 |
Gene ID | 157506 |
mRNA Refseq | NM_172037.5 |
Protein Refseq | NP_742034.1 |
MIM | 607599 |
UniProt ID | Q8IZV5 |
◆ Recombinant Proteins | ||
RDH10-3836R | Recombinant Rhesus monkey RDH10 Protein, His-tagged | +Inquiry |
RDH10-1789HFL | Recombinant Full Length Human RDH10 Protein, C-Flag-tagged | +Inquiry |
Rdh10-5443M | Recombinant Mouse Rdh10 Protein, Myc/DDK-tagged | +Inquiry |
RDH10-14045M | Recombinant Mouse RDH10 Protein | +Inquiry |
RDH10-7506M | Recombinant Mouse RDH10 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RDH10-2439HCL | Recombinant Human RDH10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RDH10 Products
Required fields are marked with *
My Review for All RDH10 Products
Required fields are marked with *
0
Inquiry Basket