Recombinant Full Length Human RDX Protein, C-Flag-tagged
Cat.No. : | RDX-786HFL |
Product Overview : | Recombinant Full Length Human RDX Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Radixin is a cytoskeletal protein that may be important in linking actin to the plasma membrane. It is highly similar in sequence to both ezrin and moesin. The radixin gene has been localized by fluorescence in situ hybridization to 11q23. A truncated version representing a pseudogene (RDXP2) was assigned to Xp21.3. Another pseudogene that seemed to lack introns (RDXP1) was mapped to 11p by Southern and PCR analyses. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 68.4 kDa |
AA Sequence : | MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDV KKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKE IHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKN KKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRI LALCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLERAQLENEKEKREIAEKEKERIEREKEELMER LKQIEEQTIKAQKELEEQTRKALELDQERKRAKEEAERLEKERRAAEEAKSAIAKQAADQMKNQEQLAAE LAEFTAKIALLEEAKKKKEEEATEWQHKAFAAQEDLEKTKEELKTVMSAPPPPPPPPVIPPTENEHDEHD ENNAEASAELSNEGVMNHRSEEERVTETQKNERVKKQLQALSSELAQARDETKKTQNDVLHAENVKAGRD KYKTLRQIRQGNTKQRIDEFEAMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Regulation of actin cytoskeleton |
Full Length : | Full L. |
Gene Name | RDX radixin [ Homo sapiens (human) ] |
Official Symbol | RDX |
Synonyms | DFNB24 |
Gene ID | 5962 |
mRNA Refseq | NM_002906.4 |
Protein Refseq | NP_002897.1 |
MIM | 179410 |
UniProt ID | P35241 |
◆ Recombinant Proteins | ||
RDX-1873H | Recombinant Human RDX Protein, His (Fc)-Avi-tagged | +Inquiry |
RDX-429HF | Recombinant Full Length Human RDX Protein | +Inquiry |
RDX-6316C | Recombinant Chicken RDX | +Inquiry |
Rdx-5445M | Recombinant Mouse Rdx Protein, Myc/DDK-tagged | +Inquiry |
RDX-6794H | Recombinant Human RDX protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RDX-2433HCL | Recombinant Human RDX 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RDX Products
Required fields are marked with *
My Review for All RDX Products
Required fields are marked with *
0
Inquiry Basket