Recombinant Full Length Human RECQL Protein, C-Flag-tagged
Cat.No. : | RECQL-617HFL |
Product Overview : | Recombinant Full Length Human RECQL Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a member of the RecQ DNA helicase family. DNA helicases are enzymes involved in various types of DNA repair, including mismatch repair, nucleotide excision repair and direct repair. The encoded protein is involved in the processing of Holliday junctions, the suppression of sister chromatid exchanges, telomere maintenance, and is required for genotoxic stress resistance. Defects in this gene have been associated with several types of cancer. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 73.3 kDa |
AA Sequence : | MASVSALTEELDSITSELHAVEIQIQELTERQQELIQKKKVLTKKIKQCLEDSDAGASNEYDSSPAAWNK EDFPWSGKVKDILQNVFKLEKFRPLQLETINVTMAGKEVFLVMPTGGGKSLCYQLPALCSDGFTLVICPL ISLMEDQLMVLKQLGISATMLNASSSKEHVKWVHAEMVNKNSELKLIYVTPEKIAKSKMFMSRLEKAYEA RRFTRIAVDEVHCCSQWGHDFRPDYKALGILKRQFPNASLIGLTATATNHVLTDAQKILCIEKCFTFTAS FNRPNLYYEVRQKPSNTEDFIEDIVKLINGRYKGQSGIIYCFSQKDSEQVTVSLQNLGIHAGAYHANLEP EDKTTVHRKWSANEIQVVVATVAFGMGIDKPDVRFVIHHSMSKSMENYYQESGRAGRDDMKADCILYYGF GDIFRISSMVVMENVGQQKLYEMVSYCQNISKCRRVLMAQHFDEVWNSEACNKMCDNCCKDSAFERKNIT EYCRDLIKILKQAEELNEKLTPLKLIDSWMGKGAAKLRVAGVVAPTLPREDLEKIIAHFLIQQYLKEDYS FTAYATISYLKIGPKANLLNNEAHAITMQVTKSTQNSFRAESSQTCHSEQGDKKMEKKNSGNFQKKAANM LQQSGSKNTGAKKRKIDDATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | RECQL RecQ like helicase [ Homo sapiens (human) ] |
Official Symbol | RECQL |
Synonyms | RecQ1; RECQL1 |
Gene ID | 5965 |
mRNA Refseq | NM_032941.3 |
Protein Refseq | NP_116559.1 |
MIM | 600537 |
UniProt ID | P46063 |
◆ Recombinant Proteins | ||
RECQL-5963C | Recombinant Chicken RECQL | +Inquiry |
Recql-5448M | Recombinant Mouse Recql Protein, Myc/DDK-tagged | +Inquiry |
RECQL-4143Z | Recombinant Zebrafish RECQL | +Inquiry |
RECQL-2688H | Recombinant Human RECQL Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RECQL-4641R | Recombinant Rat RECQL Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RECQL-2430HCL | Recombinant Human RECQL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RECQL Products
Required fields are marked with *
My Review for All RECQL Products
Required fields are marked with *
0
Inquiry Basket