Recombinant Full Length Human REEP2 Protein, C-Flag-tagged
Cat.No. : | REEP2-1667HFL |
Product Overview : | Recombinant Full Length Human REEP2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the receptor expression enhancing protein family. Studies of a related gene in mouse suggest that the encoded protein is found in the cell membrane and enhances the function of sweet taste receptors. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 28.1 kDa |
AA Sequence : | MVSWIISRLVVLIFGTLYPAYSSYKAVKTKNVKEYVKWMMYWIVFAFFTTAETLTDIVLSWFPFYFELKI AFVIWLLSPYTKGSSVLYRKFVHPTLSNKEKEIDEYITQARDKSYETMMRVGKRGLNLAANAAVTAAAKG VLSEKLRSFSMQDLTLIRDEDALPLQRPDGRLRPSPGSLLDTIEDLGDDPALSLRSSTNPADSRTEASED DMGDKAPKRAKPIKKAPKAEPLASKTLKTRPKKKTSGGGDSATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Full Length : | Full L. |
Gene Name | REEP2 receptor accessory protein 2 [ Homo sapiens (human) ] |
Official Symbol | REEP2 |
Synonyms | SPG72; Yip2d; C5orf19; SGC32445 |
Gene ID | 51308 |
mRNA Refseq | NM_016606.4 |
Protein Refseq | NP_057690.2 |
MIM | 609347 |
UniProt ID | Q9BRK0 |
◆ Cell & Tissue Lysates | ||
REEP2-2428HCL | Recombinant Human REEP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All REEP2 Products
Required fields are marked with *
My Review for All REEP2 Products
Required fields are marked with *