Recombinant Full Length Human RELL2 Protein, C-Flag-tagged
Cat.No. : | RELL2-1023HFL |
Product Overview : | Recombinant Full Length Human RELL2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to enable collagen binding activity. Involved in positive regulation of p38MAPK cascade. Predicted to be located in extracellular matrix. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 32.2 kDa |
AA Sequence : | MSEPQPDLEPPQHGLYMLFLLVLVFFLMGLVGFMICHVLKKKGYRCRTSRGSEPDDAQLQPPEDDDMNED TVERIVRCIIQNEANAEALKEMLGDSEGEGTVQLSSVDATSSLQDGAPSHHHTVHLGPAAPCIHCSRSKR PPLVRQGRSKEGKSRPRTGETTVFSVGRFRVTHIEKRYGLHEHRDGSPTDRSWGSRGGQDPGGGQGSGGG QPKAGMPAMERLPPERPQPQVLASPPVQNGGLRDSSLTPRALEGNPRASAEPTLRAGGRGPSPGLPTQEA NGEPSKPDTSDHQVSLPQGAGSMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Full Length : | Full L. |
Gene Name | RELL2 RELT like 2 [ Homo sapiens (human) ] |
Official Symbol | RELL2 |
Synonyms | C5orf16 |
Gene ID | 285613 |
mRNA Refseq | NM_001130029.2 |
Protein Refseq | NP_001123501.1 |
MIM | 611213 |
UniProt ID | Q8NC24 |
◆ Recombinant Proteins | ||
RELL2-3742Z | Recombinant Zebrafish RELL2 | +Inquiry |
RFL15334MF | Recombinant Full Length Mouse Relt-Like Protein 2(Rell2) Protein, His-Tagged | +Inquiry |
RELL2-3847R | Recombinant Rhesus monkey RELL2 Protein, His-tagged | +Inquiry |
RFL36224RF | Recombinant Full Length Rat Relt-Like Protein 2(Rell2) Protein, His-Tagged | +Inquiry |
RELL2-4992R | Recombinant Rat RELL2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RELL2-2422HCL | Recombinant Human RELL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RELL2 Products
Required fields are marked with *
My Review for All RELL2 Products
Required fields are marked with *