Recombinant Full Length Human Relt-Like Protein 2(Rell2) Protein, His-Tagged
Cat.No. : | RFL9056HF |
Product Overview : | Recombinant Full Length Human RELT-like protein 2(RELL2) Protein (Q8NC24) (1-303aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-303) |
Form : | Lyophilized powder |
AA Sequence : | MSEPQPDLEPPQHGLYMLFLLVLVFFLMGLVGFMICHVLKKKGYRCRTSRGSEPDDAQLQ PPEDDDMNEDTVERIVRCIIQNEANAEALKEMLGDSEGEGTVQLSSVDATSSLQDGAPSH HHTVHLGSAAPCLHCSRSKRPPLVRQGRSKEGKSRPRTGETTVFSVGRFRVTHIEKRYGL HEHRDGSPTDRSWGSGGGQDPGGGQGSGGGQPKAGMPAMERLPPERPQPQVLASPPVQNG GLRDSSLTPRALEGNPRASAEPTLRAGGRGPSPGLPTQEANGQPSKPDTSDHQVSLPQGA GSM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | RELL2 |
Synonyms | RELL2; C5orf16; UNQ9423/PRO34565; RELT-like protein 2 |
UniProt ID | Q8NC24 |
◆ Recombinant Proteins | ||
RELL2-3664R | Recombinant Rhesus Macaque RELL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL9056HF | Recombinant Full Length Human Relt-Like Protein 2(Rell2) Protein, His-Tagged | +Inquiry |
RELL2-1023HFL | Recombinant Full Length Human RELL2 Protein, C-Flag-tagged | +Inquiry |
RELL2-4651R | Recombinant Rat RELL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RELL2-1880H | Recombinant Human RELL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RELL2-2422HCL | Recombinant Human RELL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RELL2 Products
Required fields are marked with *
My Review for All RELL2 Products
Required fields are marked with *
0
Inquiry Basket