Recombinant Full Length Human REN Protein, C-Flag-tagged
Cat.No. : | REN-648HFL |
Product Overview : | Recombinant Full Length Human REN Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes renin, an aspartic protease that is secreted by the kidneys. Renin is a part of the renin-angiotensin-aldosterone system involved in regulation of blood pressure, and electrolyte balance. This enzyme catalyzes the first step in the activation pathway of angiotensinogen by cleaving angiotensinogen to form angiotensin I, which is then converted to angiotensin II by angiotensin I converting enzyme. This cascade can result in aldosterone release, narrowing of blood vessels, and increase in blood pressure as angiotension II is a vasoconstrictive peptide. Transcript variants that encode different protein isoforms and that arise from alternative splicing and the use of alternative promoters have been described, but their full-length nature has not been determined. Mutations in this gene have been shown to cause hyperuricemic nephropathy familial juvenile 2, familial hyperproreninemia, and renal tubular dysgenesis. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 42.3 kDa |
AA Sequence : | MDGWRRMPRWGLLLLLWGSCTFGLPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEWSQPMKRLTLG NTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKH NGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIF DNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSST LLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADY VFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALARTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein |
Protein Pathways : | Renin-angiotensin system |
Full Length : | Full L. |
Gene Name | REN renin [ Homo sapiens (human) ] |
Official Symbol | REN |
Synonyms | RTD; HNFJ2; ADTKD4 |
Gene ID | 5972 |
mRNA Refseq | NM_000537.4 |
Protein Refseq | NP_000528.1 |
MIM | 179820 |
UniProt ID | P00797 |
◆ Recombinant Proteins | ||
REN-700D | Recombinant Dog Renin, His-tagged | +Inquiry |
REN-1208H | Recombinant Human REN Protein, His-tagged | +Inquiry |
REN-73H | Recombinant Human REN | +Inquiry |
REN-084H | Active Recombinant Human REN Protein | +Inquiry |
REN-31180TH | Recombinant Human REN, His-tagged | +Inquiry |
◆ Native Proteins | ||
REN -16H | Recombinant Human Prorenin, His-tagged | +Inquiry |
REN-388H | Active Native Human Renin Antigen | +Inquiry |
REN-245H | Active Native Human Renin | +Inquiry |
Ren -72R | Recombinant Rat Prorenin, His tag | +Inquiry |
◆ Cell & Tissue Lysates | ||
REN-2862HCL | Recombinant Human REN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All REN Products
Required fields are marked with *
My Review for All REN Products
Required fields are marked with *
0
Inquiry Basket