Recombinant Full Length Human Retinoic Acid-Induced Protein 3(Gprc5A) Protein, His-Tagged
Cat.No. : | RFL32696HF |
Product Overview : | Recombinant Full Length Human Retinoic acid-induced protein 3(GPRC5A) Protein (Q8NFJ5) (1-357aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-357) |
Form : | Lyophilized powder |
AA Sequence : | MATTVPDGCRNGLKSKYYRLCDKAEAWGIVLETVATAGVVTSVAFMLTLPILVCKVQDSN RRKMLPTQFLFLLGVLGIFGLTFAFIIGLDGSTGPTRFFLFGILFSICFSCLLAHAVSLT KLVRGRKPLSLLVILGLAVGFSLVQDVIAIEYIVLTMNRTNVNVFSELSAPRRNEDFVLL LTYVLFLMALTFLMSSFTFCGSFTGWKRHGAHIYLTMLLSIAIWVAWITLLMLPDFDRRW DDTILSSALAANGWVFLLAYVSPEFWLLTKQRNPMDYPVEDAFCKPQLVKKSYGVENRAY SQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDYEVKKEGS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GPRC5A |
Synonyms | GPRC5A; GPCR5A; RAI3; RAIG1; Retinoic acid-induced protein 3; G-protein coupled receptor family C group 5 member A; Phorbol ester induced gene 1; PEIG-1; Retinoic acid-induced gene 1 protein; RAIG-1 |
UniProt ID | Q8NFJ5 |
◆ Recombinant Proteins | ||
GPRC5A-1014H | Recombinant Human GPRC5A Protein, His (Fc)-Avi-tagged | +Inquiry |
GPRC5A-3233H | Recombinant Human GPRC5A Protein (Thr269-Ser357), N-GST tagged | +Inquiry |
GPRC5A-1339H | Recombinant Human GPRC5A protein, GST-tagged | +Inquiry |
GPRC5A-751HFL | Recombinant Full Length Human GPRC5A Protein, C-Flag-tagged | +Inquiry |
GPRC5A-5284H | Recombinant Human GPRC5A Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPRC5A-5771HCL | Recombinant Human GPRC5A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPRC5A Products
Required fields are marked with *
My Review for All GPRC5A Products
Required fields are marked with *