Recombinant Full Length Human REXO2 Protein, GST-tagged
Cat.No. : | REXO2-4714HF |
Product Overview : | Human DKFZP566E144 full-length ORF ( AAH03502, 1 a.a. - 79 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 79 amino acids |
Description : | This gene encodes a 3'-to-5' exonuclease specific for small (primarily 5 nucleotides or less in length) single-stranded RNA and DNA oligomers. This protein may have a role in DNA repair, replication, and recombination, and in RNA processing and degradation. It may also be involved in resistance of human cells to UV-C-induced cell death through its role in the DNA repair process. [provided by RefSeq, Nov 2011] |
Molecular Mass : | 34.43 kDa |
AA Sequence : | MLGGSLGSRLLRGVGGSHGRFGARGVREGGAAMAAGESMAQRMVWVDLEMTGLDIEKDQIIEMACLITDSDLNILAEGT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | REXO2 REX2, RNA exonuclease 2 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | REXO2 |
Synonyms | REXO2; REX2, RNA exonuclease 2 homolog (S. cerevisiae); oligoribonuclease, mitochondrial; CGI 114; DKFZP566E144; SFN; small fragment nuclease; RNA exonuclease 2 homolog; RFN; REX2; CGI-114; MGC111570; DKFZp566E144; |
Gene ID | 25996 |
mRNA Refseq | NM_015523 |
Protein Refseq | NP_056338 |
MIM | 607149 |
UniProt ID | Q9Y3B8 |
◆ Recombinant Proteins | ||
REXO2-1883H | Recombinant Human REXO2 Protein, His (Fc)-Avi-tagged | +Inquiry |
REXO2-4033H | Recombinant Human REXO2 Protein, GST-tagged | +Inquiry |
REXO2-14094M | Recombinant Mouse REXO2 Protein | +Inquiry |
REXO2-7537M | Recombinant Mouse REXO2 Protein, His (Fc)-Avi-tagged | +Inquiry |
REXO2-598C | Recombinant Cynomolgus Monkey REXO2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
REXO2-2413HCL | Recombinant Human REXO2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All REXO2 Products
Required fields are marked with *
My Review for All REXO2 Products
Required fields are marked with *