Recombinant Full Length Human RFTN2 Protein, C-Flag-tagged
Cat.No. : | RFTN2-1276HFL |
Product Overview : | Recombinant Full Length Human RFTN2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to act upstream of or within dsRNA transport and response to exogenous dsRNA. Predicted to be located in plasma membrane. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 55.7 kDa |
AA Sequence : | MGCGLRKLEDPDDSSPGKIFSTLKRPQVETKTEFAYEYVLLDFTLQASSNPEVIKINSILDIVTKVENYY LKGYIVGAIHPVIQPVGQRKHLPASYLYRVVLLRLKLSPKNSAAPSGQRRPRLVIEECPLTSEAQTNDAA KELIEKINVAAKRGMKFVGFISQHYSPSKFCNGTNHDGDIESMLHVRHGSDENCRSWNEGTLSGQSSESG IEEELHHESGQYQMEQNGSPTSSKSRKGEASDNKLYTVFNAFDDDSTSWAYQEGILSMKVTRKGSVISTL DADWLELTTFYYKQGLSLIDSFVFWETSKGEHLPKSLEGFFIYEEEGSGVPGSSRKGNDAIVVEQWTVIE GCEIKTDYGPLLHTLAEFGWLLTSVLPTPVLRHDSEGNLATKQIVFLQRPVMWNSAAQTPDKKASRHIKG EDKNKATSRSIGLDTTSSQPAESRHLPEECRLSPSRECWTKEGRLAQHNSFSGFSSSDNVLRELDDGQFD QEDGVTQVTCMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | RFTN2 raftlin family member 2 [ Homo sapiens (human) ] |
Official Symbol | RFTN2 |
Synonyms | C2orf11; Raftlin-2 |
Gene ID | 130132 |
mRNA Refseq | NM_144629.3 |
Protein Refseq | NP_653230.2 |
MIM | 618215 |
UniProt ID | Q52LD8 |
◆ Recombinant Proteins | ||
RFTN2-4826C | Recombinant Chicken RFTN2 | +Inquiry |
Rftn2-5479M | Recombinant Mouse Rftn2 Protein, Myc/DDK-tagged | +Inquiry |
RFTN2-14109M | Recombinant Mouse RFTN2 Protein | +Inquiry |
RFTN2-4541H | Recombinant Human RFTN2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFTN2-3860R | Recombinant Rhesus monkey RFTN2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RFTN2-2402HCL | Recombinant Human RFTN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RFTN2 Products
Required fields are marked with *
My Review for All RFTN2 Products
Required fields are marked with *
0
Inquiry Basket