Recombinant Full Length Human RGS3 Protein
Cat.No. : | RGS3-452HF |
Product Overview : | Recombinant full length Human RGS3 , containing an N-terminal proprietary tag; predicted MWt 47.23 kDa |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 193 amino acids |
Description : | This gene encodes a member of the regulator of G-protein signaling (RGS) family. This protein is a GTP-ase activating protein which inhibits G-protein mediated signal transduction. The protein is largely cytosolic, but G-protein activation leads to translocation of this protein to the plasma membrane. A nuclear form of this protein has also been described, but its sequence has not been identified. Multiple alternatively spliced transcript variants have been described for this gene but the full-length nature of some transcripts is not yet known. |
Form : | Liquid |
Molecular Mass : | 47.230kDa inclusive of tags |
AA Sequence : | MLRGMYLTRNGNLQRRHTMKEAKDMKNKLGIFRRRSESPG APPAGKADKMMKSFKPTSEEALKWGESLEKLLVHKYGLAV FQAFLRTEFSEENLEFWLACEDFKKVKSQSKMASKAKKIF AEYIAIQACKEVNLDSYTREHTKDNLQSVTRGCFDLAQKR IFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | RGS3 regulator of G-protein signaling 3 [ Homo sapiens ] |
Official Symbol | RGS3 |
Synonyms | RGS3; regulator of G-protein signaling 3; regulator of G protein signalling 3; C2PA; FLJ20370; PDZ RGS3 |
Gene ID | 5998 |
mRNA Refseq | NM_017790 |
Protein Refseq | NP_060260 |
MIM | 602189 |
UniProt ID | P49796 |
◆ Recombinant Proteins | ||
RGS3-339H | Recombinant Human RGS3 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
RGS3-5744H | Recombinant Human RGS3 protein, His-tagged | +Inquiry |
RGS3-6029C | Recombinant Chicken RGS3 | +Inquiry |
RGS3-5019R | Recombinant Rat RGS3 Protein | +Inquiry |
Rgs3-5498M | Recombinant Mouse Rgs3 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RGS3-2376HCL | Recombinant Human RGS3 293 Cell Lysate | +Inquiry |
RGS3-2374HCL | Recombinant Human RGS3 293 Cell Lysate | +Inquiry |
RGS3-2375HCL | Recombinant Human RGS3 293 Cell Lysate | +Inquiry |
RGS3-2373HCL | Recombinant Human RGS3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RGS3 Products
Required fields are marked with *
My Review for All RGS3 Products
Required fields are marked with *
0
Inquiry Basket