Recombinant Full Length Human RHNO1 Protein, GST-tagged
| Cat.No. : | RHNO1-2024HF |
| Product Overview : | Human C12orf32 full-length ORF ( NP_113653.1, 1 a.a. - 238 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 238 amino acids |
| Description : | Involved in cellular response to radiation; recombinational repair; and regulation of cell cycle process. Located in chromosome and nucleus. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 53.1 kDa |
| AA Sequence : | MPPRKKRRQPSQKAPLLFHQQPLEGPKHSCASTQLPITHTRQVPSKPIDHSTITSWVSPDFDTAAGSLFPAYQKHQNRARHSSRKPTTSKFPHLTFESPQSSSSETLGIPLIRECPSESEKDVSRRPLVPVLSPQSCGNMSVQALQSLPYVFIPPDIQTPESSSVKEELIPQDQKENSLLSCTLHTGTPNSPEPGPVLVKDTPEDKYGIKVTWRRRQHLLAYLRERGKLSRSQFLVKS |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | RHNO1 RAD9-HUS1-RAD1 interacting nuclear orphan 1 [ Homo sapiens (human) ] |
| Official Symbol | RHNO1 |
| Synonyms | RHINO; C12orf32; HKMT1188 |
| Gene ID | 83695 |
| mRNA Refseq | NM_031465.2 |
| Protein Refseq | NP_113653.1 |
| MIM | 614085 |
| UniProt ID | Q9BSD3 |
| ◆ Recombinant Proteins | ||
| RHNO1-1275H | Recombinant Human C12orf32 Protein, His-tagged | +Inquiry |
| RHNO1-3987H | Recombinant Human RHNO1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RHNO1-498H | Recombinant Human RHNO1 Protein, GST-tagged | +Inquiry |
| RHNO1-2024HF | Recombinant Full Length Human RHNO1 Protein, GST-tagged | +Inquiry |
| RHNO1-1210H | Recombinant Human RHNO1 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RHNO1 Products
Required fields are marked with *
My Review for All RHNO1 Products
Required fields are marked with *
