Recombinant Full Length Human RHOC protein, GST-tagged
Cat.No. : | RHOC-301274H |
Product Overview : | Recombinant Human RHOC (1-193 aa) protein, fused to GST tag, was expressed in E. coli. |
Availability | July 03, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-193 a.a. |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | RHOC ras homolog family member C [ Homo sapiens ] |
Official Symbol | RHOC |
Synonyms | RHOC; ras homolog family member C; ARH9, ARHC, ras homolog gene family, member C; rho-related GTP-binding protein RhoC; RhoC; rhoC GTPase; oncogene RHO H9; rho cDNA clone 9; RAS-related homolog 9; small GTP binding protein RhoC; ras homolog gene family, member C; H9; ARH9; ARHC; RHOH9; MGC1448; MGC61427; |
Gene ID | 389 |
mRNA Refseq | NM_001042678 |
Protein Refseq | NP_001036143 |
MIM | 165380 |
UniProt ID | P08134 |
◆ Recombinant Proteins | ||
RHOC-30285TH | Recombinant Human RHOC, His-tagged | +Inquiry |
RHOC-14172M | Recombinant Mouse RHOC Protein | +Inquiry |
RHOC-572H | Recombinant Human RHOC Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RHOC-2215C | Recombinant Chicken RHOC | +Inquiry |
RHOC-1350HFL | Recombinant Full Length Human RHOC Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RHOC-2352HCL | Recombinant Human RHOC 293 Cell Lysate | +Inquiry |
RHOC-2351HCL | Recombinant Human RHOC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RHOC Products
Required fields are marked with *
My Review for All RHOC Products
Required fields are marked with *