Recombinant Full Length Human RHOC protein, GST-tagged

Cat.No. : RHOC-301274H
Product Overview : Recombinant Human RHOC (1-193 aa) protein, fused to GST tag, was expressed in E. coli.
Availability September 13, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-193 a.a.
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name RHOC ras homolog family member C [ Homo sapiens ]
Official Symbol RHOC
Synonyms RHOC; ras homolog family member C; ARH9, ARHC, ras homolog gene family, member C; rho-related GTP-binding protein RhoC; RhoC; rhoC GTPase; oncogene RHO H9; rho cDNA clone 9; RAS-related homolog 9; small GTP binding protein RhoC; ras homolog gene family, member C; H9; ARH9; ARHC; RHOH9; MGC1448; MGC61427;
Gene ID 389
mRNA Refseq NM_001042678
Protein Refseq NP_001036143
MIM 165380
UniProt ID P08134

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RHOC Products

Required fields are marked with *

My Review for All RHOC Products

Required fields are marked with *

0
cart-icon