Recombinant Full Length Human RIOK1 Protein, C-Flag-tagged
Cat.No. : | RIOK1-814HFL |
Product Overview : | Recombinant Full Length Human RIOK1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene competes with pICln for inclusion in the protein arginine methyltransferase 5 complex. This complex targets substrates for dimethylation. The encoded protein is essential for the last steps in the maturation of 40S subunits. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 65.4 kDa |
AA Sequence : | MDYRRLLMSRVVPGQFDDADSSDSENRDLKTVKEKDDILFEDLQDNVNENGEGEIEDEEEEGYDDDDDDW DWDEGVGKLAKGYVWNGGSNPQANRQTSDSSSAKMSTPADKVLRKFENKINLDKLNVTDSVINKVTEKSR QKEADMYRIKDKADRATVEQVLDPRTRMILFKMLTRGIITEINGCISTGKEANVYHASTANGESRAIKIY KTSILVFKDRDKYVSGEFRFRHGYCKGNPRKMVKTWAEKEMRNLIRLNTAEIPCPEPIMLRSHVLVMSFI GKDDMPAPLLKNVQLSESKARELYLQVIQYMRRMYQDARLVHADLSEFNMLYHGGGVYIIDVSQSVEHDH PHALEFLRKDCANVNDFFMRHSVAVMTVRELFEFVTDPSITHENMDAYLSKAMEIASQRTKEERSSQDHV DEEVFKRAYIPRTLNEVKNYERDMDIIMKLKEEDMAMNAQQDNILYQTVTGLKKDLSGVQKVPALLENQV EERTCSDSEDIGSSECSDTDSEEQGDHARPKKHTTDPDIDKKERKKMVKEAQREKRKNKIPKHVKKRKEK TAKTKKGKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protein Kinase |
Full Length : | Full L. |
Gene Name | RIOK1 RIO kinase 1 [ Homo sapiens (human) ] |
Official Symbol | RIOK1 |
Synonyms | RIO1; AD034; RRP10; bA288G3.1 |
Gene ID | 83732 |
mRNA Refseq | NM_031480.3 |
Protein Refseq | NP_113668.2 |
MIM | 617753 |
UniProt ID | Q9BRS2 |
◆ Recombinant Proteins | ||
RIOK1-7613M | Recombinant Mouse RIOK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Riok1-5520M | Recombinant Mouse Riok1 Protein, Myc/DDK-tagged | +Inquiry |
RIOK1-1612H | Recombinant Human RIOK1 protein, His & T7-tagged | +Inquiry |
RIOK1-0599H | Recombinant Human RIOK1 Protein (D2-K568), Tag Free | +Inquiry |
RIOK1-14240M | Recombinant Mouse RIOK1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RIOK1-001HCL | Recombinant Human RIOK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RIOK1 Products
Required fields are marked with *
My Review for All RIOK1 Products
Required fields are marked with *
0
Inquiry Basket