Recombinant Full Length Human RNLS Protein, GST-tagged
| Cat.No. : | RNLS-1730HF |
| Product Overview : | Human C10orf59 full-length ORF ( NP_001026879.1, 1 a.a. - 342 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 342 amino acids |
| Description : | Renalase is a flavin adenine dinucleotide-dependent amine oxidase that is secreted into the blood from the kidney (Xu et al., 2005 [PubMed 15841207]). |
| Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 64.2 kDa |
| AA Sequence : | MAQVLIVGAGMTGSLCAALLRRQTSGPLYLAVWDKADDSGGRMTTACSPHNPQCTADLGAQYITCTPHYAKKHQRFYDELLAYGVLRPLSSPIEGMVMKEGDCNFVAPQGISSIIKHYLKESGAEVYFRHRVTQINLRDDKWEVSKQTGSPEQFDLIVLTMPVPEILQLQGDITTLISECQRQQLEAVSYSSRYALGLFYEAGTKIDVPWAGQYITSNPCIRFVSIDNKKRNIESSEIGPSLVIHTTVPFGVTYLEHSIEDVQELVFQQLENILPGLPQPIATKCQKWRHSQVTNAAANCPGQMTLHHKPFLACGGDGFTQSNFDGCITSALCVLEALKNYI |
| Quality Control Test : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | RNLS renalase, FAD dependent amine oxidase [ Homo sapiens (human) ] |
| Official Symbol | RNLS |
| Synonyms | C10orf59; RENALASE |
| Gene ID | 55328 |
| mRNA Refseq | NM_001031709.1 |
| Protein Refseq | NP_001026879.1 |
| MIM | 609360 |
| UniProt ID | Q5VYX0 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RNLS Products
Required fields are marked with *
My Review for All RNLS Products
Required fields are marked with *



