Recombinant Full Length Human RNLS Protein, GST-tagged

• Cat.No.: RNLS-1730HF
• Product Overview: Human C10orf59 full-length ORF ( NP_001026879.1, 1 a.a. - 342 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 342 amino acids
• Description: Renalase is a flavin adenine dinucleotide-dependent amine oxidase that is secreted into the blood from the kidney (Xu et al., 2005 [PubMed 15841207]).
• Form: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 64.2 kDa
• AA Sequence: MAQVLIVGAGMTGSLCAALLRRQTSGPLYLAVWDKADDSGGRMTTACSPHNPQCTADLGAQYITCTPHYAKKHQRFYDELLAYGVLRPLSSPIEGMVMKEGDCNFVAPQGISSIIKHYLKESGAEVYFRHRVTQINLRDDKWEVSKQTGSPEQFDLIVLTMPVPEILQLQGDITTLISECQRQQLEAVSYSSRYALGLFYEAGTKIDVPWAGQYITSNPCIRFVSIDNKKRNIESSEIGPSLVIHTTVPFGVTYLEHSIEDVQELVFQQLENILPGLPQPIATKCQKWRHSQVTNAAANCPGQMTLHHKPFLACGGDGFTQSNFDGCITSALCVLEALKNYI
• Quality Control Test: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: RNLS renalase, FAD dependent amine oxidase [ Homo sapiens (human) ]
• Official Symbol: RNLS
• Synonyms: C10orf59; RENALASE
• Gene ID: 55328
• mRNA Refseq: NM_001031709.1
• Protein Refseq: NP_001026879.1
• MIM: 609360
• UniProt ID: Q5VYX0