Recombinant Full Length Human RP2 Protein, C-Flag-tagged

Species :	Human
Source :	Mammalian Cells
Tag :	Flag
Description :	The RP2 locus has been implicated as one cause of X-linked retinitis pigmentosa. The predicted gene product shows homology with human cofactor C, a protein involved in the ultimate step of beta-tubulin folding. Progressive retinal degeneration may therefore be due to the accumulation of incorrectly-folded photoreceptor or neuron-specific tubulin isoforms followed by progressive cell death.
Form :	25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass :	39.5 kDa
AA Sequence :	MGCFFSKRRKADKESRPENEEERPKQYSWDQREKVDPKDYMFSGLKDETVGRLPGTVAGQQFLIQDCENC NIYIFDHSATVTIDDCTNCIIFLGPVKGSVFFRNCRDCKCTLACQQFRVRDCRKLEVFLCCATQPIIESS SNIKFGCFQWYYPELAFQFKDAGLSIFNNTWSNIHDFTPVSGELNWSLLPEDAVVQDYVPIPTTEELKAV RVSTEANRSIVPISRGQRQKSSDESCLVVLFAGDYTIANARKLIDEMVGKGFFLVQTKEVSMKAEDAQRV FREKAPDFLPLLNKGPVIALEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMGITRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity :	> 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability :	Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage :	Store at -80 centigrade.
Concentration :	>50 ug/mL as determined by microplate BCA method.
Preparation :	Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families :	Druggable Genome
Full Length :	Full L.

Gene Name	RP2 RP2 activator of ARL3 GTPase [ Homo sapiens (human) ]
Official Symbol	RP2
Synonyms	XRP2; NME10; TBCCD2; NM23-H10; DELXp11.3
Gene ID	6102
mRNA Refseq	NM_006915.3
Protein Refseq	NP_008846.2
MIM	300757
UniProt ID	O75695