Recombinant Full Length Human RPL13AP17 Protein, GST-tagged
| Cat.No. : | RPL13AP17-6396HF |
| Product Overview : | Human MGC34774 full-length ORF ( NP_976053.1, 1 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 170 amino acids |
| Description : | RPL13AP17 (Ribosomal Protein L13a Pseudogene 17) is a Pseudogene. |
| Molecular Mass : | 44.9 kDa |
| AA Sequence : | MNSVSVVMMLTSKPLHILGRFITKPLLFTNSMENFELTPSRHGRVHHQSCHEAPRTYKVAAEDSRKTEPGAQWPRPSCGPPGSHLGQVGSAGKETGGRAPRGHQHFWQFLEKQIKVSGLPLQADEHQPFPRPARPAIPGPPAHLLVALQNQVGPGCPGPPYGVLWDLTAL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | RPL13AP17 ribosomal protein L13a pseudogene 17 [ Homo sapiens (human) ] |
| Official Symbol | RPL13AP17 |
| Synonyms | RPL13AP17; ribosomal protein L13a pseudogene 17; RPL13A_6_816; |
| Gene ID | 399670 |
| ◆ Recombinant Proteins | ||
| RPL13AP17-5272H | Recombinant Human RPL13AP17 Protein, GST-tagged | +Inquiry |
| RPL13AP17-6396HF | Recombinant Full Length Human RPL13AP17 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RPL13AP17-4337HCL | Recombinant Human MGC34774 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RPL13AP17 Products
Required fields are marked with *
My Review for All RPL13AP17 Products
Required fields are marked with *
