Recombinant Human RPL13AP17 Protein, GST-tagged

Cat.No. : RPL13AP17-5272H
Product Overview : Human MGC34774 full-length ORF ( NP_976053.1, 1 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : RPL13AP17 (Ribosomal Protein L13a Pseudogene 17) is a Pseudogene.
Molecular Mass : 44.9 kDa
AA Sequence : MNSVSVVMMLTSKPLHILGRFITKPLLFTNSMENFELTPSRHGRVHHQSCHEAPRTYKVAAEDSRKTEPGAQWPRPSCGPPGSHLGQVGSAGKETGGRAPRGHQHFWQFLEKQIKVSGLPLQADEHQPFPRPARPAIPGPPAHLLVALQNQVGPGCPGPPYGVLWDLTAL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name RPL13AP17 ribosomal protein L13a pseudogene 17 [ Homo sapiens (human) ]
Official Symbol RPL13AP17
Synonyms RPL13AP17; ribosomal protein L13a pseudogene 17; RPL13A_6_816;
Gene ID 399670

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RPL13AP17 Products

Required fields are marked with *

My Review for All RPL13AP17 Products

Required fields are marked with *

0
cart-icon