Recombinant Full Length Human RPSA Protein
Cat.No. : | RPSA-447HF |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-295 of Human 67 kDa Laminin Receptor, with an N-terminal proprietary tag, 33k Da inclusive of tag. |
- Specification
- Gene Information
- Related Products
Description : | Laminins, a family of extracellular matrix glycoproteins, are the major noncollagenous constituent of basement membranes. They have been implicated in a wide variety of biological processes including cell adhesion, differentiation, migration, signaling, neurite outgrowth and metastasis. Many of the effects of laminin are mediated through interactions with cell surface receptors. These receptors include members of the integrin family, as well as non-integrin laminin-binding proteins. This gene encodes a high-affinity, non-integrin family, laminin receptor 1. This receptor has been variously called 67 kD laminin receptor, 37 kD laminin receptor precursor (37LRP) and p40 ribosome-associated protein. The amino acid sequence of laminin receptor 1 is highly conserved through evolution, suggesting a key biological function. It has been observed that the level of the laminin receptor transcript is higher in colon carcinoma tissue and lung cancer cell line than their normal counterparts. Also, there is a correlation between the upregulation of this polypeptide in cancer cells and their invasive and metastatic phenotype. Multiple copies of this gene exist, however, most of them are pseudogenes thought to have arisen from retropositional events. Two alternatively spliced transcript variants encoding the same protein have been found for this gene. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 58.560kDa inclusive of tags |
Protein Length : | 295 amino acids |
AA Sequence : | MSGALDVLQMKEEDVLKFLAAGTHLGGTNLDFQMEQYIYK RKSDGIYIINLKRTWEKLLLAARAIVAIENPADVSVISSR NTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAFREPR LLVVTDPRAGHQPLTEASYVNLPTIALCNTDSPLRYVDIA IPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPD LYFYRDPEEIEKEEQAAAEKAVTKEEFQGEWTAPAPEFTA TQPEVADWSEGVQVPSVPIQQFPTEDWSAQPATEDWSAAP TAQATEWVGATTDWS |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | RPSA ribosomal protein SA [ Homo sapiens ] |
Official Symbol : | RPSA |
Synonyms : | RPSA; ribosomal protein SA; laminin receptor 1 (67kD, ribosomal protein SA) , LAMR1; 40S ribosomal protein SA; 37LRP; LRP; p40; SA |
Gene ID : | 3921 |
mRNA Refseq : | NM_001012321 |
Protein Refseq : | NP_001012321 |
MIM : | 150370 |
UniProt ID : | P08865 |
Products Types
◆ Recombinant Protein | ||
RPSA-2595H | Recombinant Human RPSA Protein (2-295 aa), His-Myc-tagged | +Inquiry |
Rpsa-1293M | Recombinant Mouse Rpsa Protein, MYC/DDK-tagged | +Inquiry |
RPSA-4834R | Recombinant Rat RPSA Protein, His (Fc)-Avi-tagged | +Inquiry |
RPSA-3849R | Recombinant Rhesus Macaque RPSA Protein, His (Fc)-Avi-tagged | +Inquiry |
RPSA-7800M | Recombinant Mouse RPSA Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
RPSA-2155HCL | Recombinant Human RPSA 293 Cell Lysate | +Inquiry |
RPSA-2154HCL | Recombinant Human RPSA 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket