Recombinant Full Length Human RPSA Protein

Cat.No. : RPSA-447HF
Product Overview : Recombinant full length protein, corresponding to amino acids 1-295 of Human 67 kDa Laminin Receptor, with an N-terminal proprietary tag, 33k Da inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 295 amino acids
Description : Laminins, a family of extracellular matrix glycoproteins, are the major noncollagenous constituent of basement membranes. They have been implicated in a wide variety of biological processes including cell adhesion, differentiation, migration, signaling, neurite outgrowth and metastasis. Many of the effects of laminin are mediated through interactions with cell surface receptors. These receptors include members of the integrin family, as well as non-integrin laminin-binding proteins. This gene encodes a high-affinity, non-integrin family, laminin receptor 1. This receptor has been variously called 67 kD laminin receptor, 37 kD laminin receptor precursor (37LRP) and p40 ribosome-associated protein. The amino acid sequence of laminin receptor 1 is highly conserved through evolution, suggesting a key biological function. It has been observed that the level of the laminin receptor transcript is higher in colon carcinoma tissue and lung cancer cell line than their normal counterparts. Also, there is a correlation between the upregulation of this polypeptide in cancer cells and their invasive and metastatic phenotype. Multiple copies of this gene exist, however, most of them are pseudogenes thought to have arisen from retropositional events. Two alternatively spliced transcript variants encoding the same protein have been found for this gene.
Form : Liquid
Molecular Mass : 58.560kDa inclusive of tags
AA Sequence : MSGALDVLQMKEEDVLKFLAAGTHLGGTNLDFQMEQYIYK RKSDGIYIINLKRTWEKLLLAARAIVAIENPADVSVISSR NTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAFREPR LLVVTDPRAGHQPLTEASYVNLPTIALCNTDSPLRYVDIA IPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPD LYFYRDPEEIEKEEQAAAEKAVTKEEFQGEWTAPAPEFTA TQPEVADWSEGVQVPSVPIQQFPTEDWSAQPATEDWSAAP TAQATEWVGATTDWS
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name RPSA ribosomal protein SA [ Homo sapiens ]
Official Symbol RPSA
Synonyms RPSA; ribosomal protein SA; laminin receptor 1 (67kD, ribosomal protein SA) , LAMR1; 40S ribosomal protein SA; 37LRP; LRP; p40; SA
Gene ID 3921
mRNA Refseq NM_001012321
Protein Refseq NP_001012321
MIM 150370
UniProt ID P08865

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RPSA Products

Required fields are marked with *

My Review for All RPSA Products

Required fields are marked with *

0
cart-icon