Recombinant Full Length Human RRN3P1 Protein, GST-tagged

• Cat.No.: RRN3P1-5921HF
• Product Overview: Human LOC730092 full-length ORF ( ENSP00000326495, 1 a.a. - 152 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 152 amino acids
• Description: RRN3P1 (RRN3 Homolog, RNA Polymerase I Transcription Factor Pseudogene 1) is a Pseudogene.
• Molecular Mass: 43.7 kDa
• AA Sequence: MGFAEAFLEHLWKNLQDPSNPAIIRQAAGNYIGSFLARAKFISLITVKPCLDLLVNWLHIYLNNQDSGTKAFCDVALHGPFYSACQAVFYTFVFRHKQLLSGNLKEGLQYPQSLNFERIVMSQLNPLKICLPSVVNFFAAITKMKTCGYGWW
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: RRN3P1 RRN3 homolog, RNA polymerase I transcription factor pseudogene 1 [ Homo sapiens (human) ]
• Official Symbol: RRN3P1
• Synonyms: RRN3P1; RRN3 homolog, RNA polymerase I transcription factor pseudogene 1; RNA polymerase I transcription factor homolog pseudogene 1; RRN3 RNA polymerase I transcription factor homolog pseudogene
• Gene ID: 730092
• UniProt ID: Q2M238