Recombinant Full Length Human RS1 Protein, C-Flag-tagged
Cat.No. : | RS1-561HFL |
Product Overview : | Recombinant Full Length Human RS1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes an extracellular protein that plays a crucial role in the cellular organization of the retina. The encoded protein is assembled and secreted from photoreceptors and bipolar cells as a homo-oligomeric protein complex. Mutations in this gene are responsible for X-linked retinoschisis, a common, early-onset macular degeneration in males that results in a splitting of the inner layers of the retina and severe loss in vision. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 23 kDa |
AA Sequence : | MSRKIEGFLLLLLFGYEATLGLSSTEDEGEDPWYQKACKCDCQGGPNALWSAGATSLDCIPECPYHKPLG FESGEVTPDQITCSNPEQYVGWYSSWTANKARLNSQGFGCAWLSKFQDSSQWLQIDLKEIKVISGILTQG RCDIDEWMTKYSVQYRTDERLNWIYYKDQTGNNRVFYGNSDRTSTVQNLLRPPIISRFIRLIPLGWHVRI AIRMELLECVSKCATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Secreted Protein |
Full Length : | Full L. |
Gene Name | RS1 retinoschisin 1 [ Homo sapiens (human) ] |
Official Symbol | RS1 |
Synonyms | RS; XLRS1 |
Gene ID | 6247 |
mRNA Refseq | NM_000330.4 |
Protein Refseq | NP_000321.1 |
MIM | 300839 |
UniProt ID | O15537 |
◆ Recombinant Proteins | ||
RS1-1730H | Recombinant Human RS1 protein, His & GST-tagged | +Inquiry |
RS1-5226H | Recombinant Human RS1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RS1-3452H | Recombinant Human RS1 protein, His-tagged | +Inquiry |
RS1-3865C | Recombinant Chicken RS1 | +Inquiry |
RS1-3857R | Recombinant Rhesus Macaque RS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RS1-2137HCL | Recombinant Human RS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RS1 Products
Required fields are marked with *
My Review for All RS1 Products
Required fields are marked with *
0
Inquiry Basket