Recombinant Full Length Human RSPH9 Protein, GST-tagged
Cat.No. : | RSPH9-3480HF |
Product Overview : | Human C6orf206 full-length ORF (NP_689945.2, 1 a.a. - 276 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 276 amino acids |
Description : | This gene encodes a protein thought to be a component of the radial spoke head in motile cilia and flagella. Mutations in this gene are associated with primary ciliary dyskinesia 12. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Jul 2010] |
Molecular Mass : | 57.7 kDa |
AA Sequence : | MDADSLLLSLELASGSGQGLSPDRRASLLTSLMLVKRDYRYDRVLFWGRILGLVADYYIAQGLSEDQLAPRKTLYSLNCTEWSLLPPATEEMVAQSSVVKGRFMGDPSYEYEHTELQKVNEGEKVFEEEIVVQIKEETRLVSVIDQIDKAVAIIPRGALFKTPFGPTHVNRTFEGLSLSEAKKLSSYFHFREPVELKNKTLLEKADLDPSLDFMDSLEHDIPKGSWSIQMERGNALVVLRSLLWPGLTFYHAPRTKNYGYVYVGTGEKNMDLPFML |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | RSPH9 radial spoke head 9 homolog (Chlamydomonas) [ Homo sapiens ] |
Official Symbol | RSPH9 |
Synonyms | RSPH9; radial spoke head 9 homolog (Chlamydomonas); C6orf206, chromosome 6 open reading frame 206, mitochondrial ribosomal protein S18A like 1, MRPS18AL1; radial spoke head protein 9 homolog; CILD12; FLJ30845; C6orf206; MRPS18AL1; |
Gene ID | 221421 |
mRNA Refseq | NM_001193341 |
Protein Refseq | NP_001180270 |
MIM | 612648 |
UniProt ID | Q9H1X1 |
◆ Recombinant Proteins | ||
RSPH9-3240Z | Recombinant Zebrafish RSPH9 | +Inquiry |
RSPH9-7832M | Recombinant Mouse RSPH9 Protein, His (Fc)-Avi-tagged | +Inquiry |
RSPH9-14551M | Recombinant Mouse RSPH9 Protein | +Inquiry |
RSPH9-4983C | Recombinant Chicken RSPH9 | +Inquiry |
RSPH9-0117H | Recombinant Human RSPH9 Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RSPH9-253HCL | Recombinant Human RSPH9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RSPH9 Products
Required fields are marked with *
My Review for All RSPH9 Products
Required fields are marked with *
0
Inquiry Basket