Recombinant Full Length Human RTL8B Protein, GST-tagged

• Cat.No.: RTL8B-4566HF
• Product Overview: Human FAM127C full-length ORF ( ADR82807.1, 1 a.a. - 113 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 113 amino acids
• Description: RTL8B (Retrotransposon Gag Like 8B) is a Protein Coding gene. An important paralog of this gene is RTL8A.
• Molecular Mass: 12.5 kDa
• AA Sequence: MEGRVQLMKALLARPLRPAARRWRNPIPFPETFDGDTDRLPEFIVQTSSYMFVDENTFSNDALKVTFLITRLTGPALQWVIPYIKKESPLLSDYRGFLAEMKRVFGWEEDEDF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: RTL8B retrotransposon Gag like 8B [ Homo sapiens (human) ]
• Official Symbol: RTL8B
• Synonyms: FAM127C; family with sequence similarity 127, member C; protein FAM127C; CXX1c; MAR8B; mammalian retrotransposon derived protein 8B; FLJ25577; RTL8B; retrotransposon Gag like 8B
• Gene ID: 441518
• mRNA Refseq: NM_001078173
• Protein Refseq: NP_001071641
• UniProt ID: Q17RB0