Recombinant Full Length Human RTL8B Protein, GST-tagged
| Cat.No. : | RTL8B-4566HF |
| Product Overview : | Human FAM127C full-length ORF ( ADR82807.1, 1 a.a. - 113 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 113 amino acids |
| Description : | RTL8B (Retrotransposon Gag Like 8B) is a Protein Coding gene. An important paralog of this gene is RTL8A. |
| Molecular Mass : | 12.5 kDa |
| AA Sequence : | MEGRVQLMKALLARPLRPAARRWRNPIPFPETFDGDTDRLPEFIVQTSSYMFVDENTFSNDALKVTFLITRLTGPALQWVIPYIKKESPLLSDYRGFLAEMKRVFGWEEDEDF |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | RTL8B retrotransposon Gag like 8B [ Homo sapiens (human) ] |
| Official Symbol | RTL8B |
| Synonyms | FAM127C; family with sequence similarity 127, member C; protein FAM127C; CXX1c; MAR8B; mammalian retrotransposon derived protein 8B; FLJ25577; RTL8B; retrotransposon Gag like 8B |
| Gene ID | 441518 |
| mRNA Refseq | NM_001078173 |
| Protein Refseq | NP_001071641 |
| UniProt ID | Q17RB0 |
| ◆ Recombinant Proteins | ||
| RTL8B-3698H | Recombinant Human RTL8B Protein, GST-tagged | +Inquiry |
| RTL8B-4566HF | Recombinant Full Length Human RTL8B Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RTL8B Products
Required fields are marked with *
My Review for All RTL8B Products
Required fields are marked with *
