Recombinant Human RTL8B Protein, GST-tagged

Cat.No. : RTL8B-3698H
Product Overview : Human FAM127C full-length ORF ( ADR82807.1, 1 a.a. - 113 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : RTL8B (Retrotransposon Gag Like 8B) is a Protein Coding gene. An important paralog of this gene is RTL8A.
Molecular Mass : 12.5 kDa
AA Sequence : MEGRVQLMKALLARPLRPAARRWRNPIPFPETFDGDTDRLPEFIVQTSSYMFVDENTFSNDALKVTFLITRLTGPALQWVIPYIKKESPLLSDYRGFLAEMKRVFGWEEDEDF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name RTL8B retrotransposon Gag like 8B [ Homo sapiens (human) ]
Official Symbol RTL8B
Synonyms FAM127C; family with sequence similarity 127, member C; protein FAM127C; CXX1c; MAR8B; mammalian retrotransposon derived protein 8B; FLJ25577; RTL8B; retrotransposon Gag like 8B
Gene ID 441518
mRNA Refseq NM_001078173
Protein Refseq NP_001071641
UniProt ID Q17RB0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RTL8B Products

Required fields are marked with *

My Review for All RTL8B Products

Required fields are marked with *

0
cart-icon
0
compare icon