Recombinant Full Length Human RTL8C Protein, GST-tagged
| Cat.No. : | RTL8C-2361HF |
| Product Overview : | Human CXX1 full-length ORF ( NP_001071639.1, 1 a.a. - 113 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 113 amino acids |
| Description : | RTL8C (Retrotransposon Gag Like 8C) is a Protein Coding gene. An important paralog of this gene is RTL8A. |
| Molecular Mass : | 39.6 kDa |
| AA Sequence : | MDGRVQLIKALLALPIRPATRRWRNPIPFPETFDGDTDRLPEFIVQTGSYMFVDENTFSSDALKVTFLITRLTGPALQWVIPYIKKESPLLNDYRGFLAEMKRVFGWEEDEDF |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | RTL8C retrotransposon Gag like 8C [ Homo sapiens (human) ] |
| Official Symbol | RTL8C |
| Synonyms | FAM127A; family with sequence similarity 127, member A; CAAX box 1 , CXX1; protein FAM127A; Mar8; MAR8C; Mart8; CAAX box 1; mammalian retrotransposon derived protein 8C; CXX1; MART8C; MGC117411; |
| Gene ID | 8933 |
| mRNA Refseq | NM_001078171 |
| Protein Refseq | NP_001071639 |
| MIM | 300213 |
| UniProt ID | A6ZKI3 |
| ◆ Recombinant Proteins | ||
| RTL8C-2361HF | Recombinant Full Length Human RTL8C Protein, GST-tagged | +Inquiry |
| RTL8C-2203H | Recombinant Human RTL8C Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RTL8C Products
Required fields are marked with *
My Review for All RTL8C Products
Required fields are marked with *
