Recombinant Full Length Human RTN1 Protein

• Cat.No.: RTN1-450HF
• Product Overview: Recombinant full length Human Reticulon 1 Isoform 3 with an N-terminal proprietary tag; predicted MWt 48.99 kDa.

Specification

• Description: This gene belongs to the family of reticulon encoding genes. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells. This gene is considered to be a specific marker for neurological diseases and cancer, and is a potential molecular target for therapy. Alternative splicing results in multiple transcript variants.
• Source: In Vitro Cell Free System
• Species: Human
• Form: Liquid
• Molecular Mass: 48.990kDa inclusive of tags
• Protein Length: 208 amino acids
• AA Sequence: MQATADSTKMDCVWSNWKSQAIDLLYWRDIKQTGIVFGSF LLLLFSLTQFSVVSVVAYLALAALSATISFRIYKSVLQAV QKTDEGHPFKAYLELEITLSQEQIQKYTDCLQFYVNSTLK ELRRLFLVQDLVDSLKFAVLMWLLTYVGALFNGLTLLLMA VVSMFTLPVVYVKHQAQIDQYLGLVRTHINAVVAKIQAKI PGAKRHAE
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: RTN1 reticulon 1 [ Homo sapiens ]
• Official Symbol: RTN1
• Synonyms: RTN1; reticulon 1; neuroendocrine specific protein , NSP; reticulon-1
• Gene ID: 6252
• mRNA Refseq: NM_021136
• Protein Refseq: NP_066959
• MIM: 600865
• UniProt ID: Q16799