Recombinant Full Length Human RTN1 Protein

Cat.No. : RTN1-450HF
Product Overview : Recombinant full length Human Reticulon 1 Isoform 3 with an N-terminal proprietary tag; predicted MWt 48.99 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 208 amino acids
Description : This gene belongs to the family of reticulon encoding genes. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells. This gene is considered to be a specific marker for neurological diseases and cancer, and is a potential molecular target for therapy. Alternative splicing results in multiple transcript variants.
Form : Liquid
Molecular Mass : 48.990kDa inclusive of tags
AA Sequence : MQATADSTKMDCVWSNWKSQAIDLLYWRDIKQTGIVFGSF LLLLFSLTQFSVVSVVAYLALAALSATISFRIYKSVLQAV QKTDEGHPFKAYLELEITLSQEQIQKYTDCLQFYVNSTLK ELRRLFLVQDLVDSLKFAVLMWLLTYVGALFNGLTLLLMA VVSMFTLPVVYVKHQAQIDQYLGLVRTHINAVVAKIQAKI PGAKRHAE
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name RTN1 reticulon 1 [ Homo sapiens ]
Official Symbol RTN1
Synonyms RTN1; reticulon 1; neuroendocrine specific protein , NSP; reticulon-1
Gene ID 6252
mRNA Refseq NM_021136
Protein Refseq NP_066959
MIM 600865
UniProt ID Q16799

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RTN1 Products

Required fields are marked with *

My Review for All RTN1 Products

Required fields are marked with *

0
cart-icon