Recombinant Full Length Human RXRA Protein, C-Flag-tagged
Cat.No. : | RXRA-654HFL |
Product Overview : | Recombinant Full Length Human RXRA Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Protein Length : | 1-462 a.a. |
Description : | Retinoid X receptors (RXRs) and retinoic acid receptors (RARs) are nuclear receptors that mediate the biological effects of retinoids by their involvement in retinoic acid-mediated gene activation. These receptors function as transcription factors by binding as homodimers or heterodimers to specific sequences in the promoters of target genes. The protein encoded by this gene is a member of the steroid and thyroid hormone receptor superfamily of transcriptional regulators. Alternative splicing of this gene results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 50.6 kDa |
AA Sequence : | MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPINGMGPPFSVISS PMGPHSMSVPTTPTLGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVPAHPSGNMASFTKHICAICGD RSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQ RGKDRNENEVESTSSANEDMPVERILEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLV EWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVL TELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLL RLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
Protein Pathways : | Adipocytokine signaling pathway, Non-small cell lung cancer, Pathways in cancer, PPAR signaling pathway, Small cell lung cancer, Thyroid cancer |
Full Length : | Full L. |
Gene Name | RXRA retinoid X receptor alpha [ Homo sapiens (human) ] |
Official Symbol | RXRA |
Synonyms | NR2B1; RXRalpha; RXR-alpha |
Gene ID | 6256 |
mRNA Refseq | NM_002957.6 |
Protein Refseq | NP_002948.1 |
MIM | 180245 |
UniProt ID | P19793 |
◆ Recombinant Proteins | ||
RXRA-1399B | Recombinant Bovine RXRA, His-tagged | +Inquiry |
RXRA-2013H | Recombinant Human RXRA Protein, MYC/DDK-tagged | +Inquiry |
Rxra-5659M | Recombinant Mouse Rxra Protein, Myc/DDK-tagged | +Inquiry |
RXRA-5479H | Recombinant Human Retinoid X Receptor, Alpha, His-tagged | +Inquiry |
RXRA-2668H | Recombinant Human RXRA Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RXRA-1554HCL | Recombinant Human RXRA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RXRA Products
Required fields are marked with *
My Review for All RXRA Products
Required fields are marked with *
0
Inquiry Basket