Recombinant Full Length Human RXRG Protein, C-Flag-tagged
Cat.No. : | RXRG-2145HFL |
Product Overview : | Recombinant Full Length Human RXRG Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the antiproliferative effects of retinoic acid (RA). This receptor forms dimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements. This gene is expressed at significantly lower levels in non-small cell lung cancer cells. Alternatively spliced transcript variants have been described. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 50.7 kDa |
AA Sequence : | MYGNYSHFMKFPAGYGGSPGHTGSTSMSPSAALSTGKPMDSHPSYTDTPVSAPRTLSAVGTPLNALGSPY RVITSAMGPPSGALAAPPGINLVAPPSSQLNVVNSVSSSEDIKPLPGLPGIGNMNYPSTSPGSLVKHICA ICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCRDNKDCLIDKRQRNRCQYCRYQKCLVMGMKREAVQ EERQRSRERAESEAECATSGHEDMPVERILEAELAVEPKTESYGDMNMENSTNDPVTNICHAADKQLFTL VEWAKRIPHFSDLTLEDQVILLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRV LTELVSKMKDMQMDKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLL LRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQIT myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
Protein Pathways : | Adipocytokine signaling pathway, Non-small cell lung cancer, Pathways in cancer, PPAR signaling pathway, Small cell lung cancer, Thyroid cancer |
Full Length : | Full L. |
Gene Name | RXRG retinoid X receptor gamma [ Homo sapiens (human) ] |
Official Symbol | RXRG |
Synonyms | RXRC; NR2B3; RXRgamma; RXR-gamma |
Gene ID | 6258 |
mRNA Refseq | NM_006917.5 |
Protein Refseq | NP_008848.1 |
MIM | 180247 |
UniProt ID | P48443 |
◆ Recombinant Proteins | ||
RXRG-31123TH | Recombinant Human RXRG | +Inquiry |
RXRG-4061R | Recombinant Rhesus monkey RXRG Protein, His-tagged | +Inquiry |
RXRG-6846C | Recombinant Chicken RXRG | +Inquiry |
RXRG-3882H | Recombinant Human RXRG Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RXRG-3878R | Recombinant Rhesus Macaque RXRG Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RXRG-2097HCL | Recombinant Human RXRG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RXRG Products
Required fields are marked with *
My Review for All RXRG Products
Required fields are marked with *
0
Inquiry Basket