Recombinant Full Length Human S100A8 Protein, His&Myc tagged

• Cat.No.: S100A8-24HFL
• Product Overview: Recombinant human S100A8, fused to His-tag at N-terminus, fused to Myc-tag at C-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc
• Protein Length: 1-93 aa
• Description: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. Altered expression of this protein is associated with the disease cystic fibrosis. Multiple transcript variants encoding different isoforms have been found for this gene.
• Form: Liquid in 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 0.1M NaCl
• Molecular Mass: 14.5 kDa (127aa) confirmed by MALDI-TOF
• AASequence: MGSSHHHHHHSSGLVPRGSHMGSHMLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKEEQKLISEEDL
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 90% by SDS-PAGE
• Applications: SDS-PAGE
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 1 mg/mL (determined by Bradford assay)

Gene Information

• Gene Name: S100A8 S100 calcium binding protein A8 [ Homo sapiens (human) ]
• Official Symbol: S100A8
• Synonyms: S100A8; S100 calcium binding protein A8; P8; NIF; CAGA; CFAG; CGLA; L1Ag; MRP8; CP-10; MA387; 60B8AG; S100-A8; protein S100-A8; calgranulin A; calprotectin L1L subunit; cystic fibrosis antigen; leukocyte L1 complex light chain; migration inhibitory factor-related protein 8; urinary stone protein band A
• Gene ID: 6279
• mRNA Refseq: NM_002964
• Protein Refseq: NP_002955
• MIM: 123885
• UniProt ID: P05109