Recombinant Full Length Human SAMHD1 Protein, C-Flag-tagged
Cat.No. : | SAMHD1-486HFL |
Product Overview : | Recombinant Full Length Human SAMHD1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene may play a role in regulation of the innate immune response. The encoded protein is upregulated in response to viral infection and may be involved in mediation of tumor necrosis factor-alpha proinflammatory responses. Mutations in this gene have been associated with Aicardi-Goutieres syndrome. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 72 kDa |
AA Sequence : | MQRADSEQPSKRPRCDDSPRTPSNTPSAEADWSPGLELHPDYKTWGPEQVCSFLRRGGFEEPVLLKNIRE NEITGALLPCLDESRFENLGVSSLGERKKLLSYIQRLVQIHVDTMKVINDPIHGHIELHPLLVRIIDTPQ FQRLRYIKQLGGGYYVFPGASHNRFEHSLGVGYLAGCLVHALGEKQPELQISERDVLCVQIAGLCHDLGH GPFSHMFDGRFIPLARPEVKWTHEQGSVMMFEHLINSNGIKPVMEQYGLIPEEDICFIKEQIVGPLESPV EDSLWPYKGRPENKSFLYEIVSNKRNGIDVDKWDYFARDCHHLGIQNNFDYKRFIKFARVCEVDNELRIC ARDKEVGNLYDMFHTRNSLHRRAYQHKVGNIIDTMITDAFLKADDYIEITGAGEKKYRISTAIDDMEAYT KLTDNIFLEILYSTDPKLKDAREILKQIEYRNLFKYVGETQPTGQIKIKREDYESLPKEVASAKPKVLLD VKLKAEDFIVDVINMDYGMQEKNPIDHVSFYCKTAPNRAIRITKNQVSQLLPEKFVEQLIRVYCKKVDRK SLYAARQYFVQWCADRNFTKPQDGDVIAPLITPQKKEWNDSTSVQNPTRLREASKSRVQLFKDDPMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | SAMHD1 SAM and HD domain containing deoxynucleoside triphosphate triphosphohydrolase 1 [ Homo sapiens (human) ] |
Official Symbol | SAMHD1 |
Synonyms | DCIP; CHBL2; HDDC1; MOP-5; SBBI88; hSAMHD1 |
Gene ID | 25939 |
mRNA Refseq | NM_015474.4 |
Protein Refseq | NP_056289.2 |
MIM | 606754 |
UniProt ID | Q9Y3Z3 |
◆ Recombinant Proteins | ||
SAMHD1-639C | Recombinant Cynomolgus Monkey SAMHD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SAMHD1-896C | Recombinant Cynomolgus SAMHD1 Protein, His-tagged | +Inquiry |
SAMHD1-01H | Recombinant Human SAMHD1 Protein, Myc/DDK-tagged | +Inquiry |
SAMHD1-1952H | Recombinant Human SAMHD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SAMHD1-7452Z | Recombinant Zebrafish SAMHD1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SAMHD1-2072HCL | Recombinant Human SAMHD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SAMHD1 Products
Required fields are marked with *
My Review for All SAMHD1 Products
Required fields are marked with *
0
Inquiry Basket