Recombinant Human SCGB2A1 protein(19-95aa), His-tagged
| Cat.No. : | SCGB2A1-2239H |
| Product Overview : | Recombinant Human SCGB2A1 protein(O75556)(19-95aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 19-95aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 14.9 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | DSGCKLLEDMVEKTINSDISIPEYKELLQEFIDSDAAAEAMGKFKQCFLNQSHRTLKNFGLMMHTVYDSIWCNMKSN |
| Gene Name | SCGB2A1 secretoglobin, family 2A, member 1 [ Homo sapiens ] |
| Official Symbol | SCGB2A1 |
| Synonyms | SCGB2A1; secretoglobin, family 2A, member 1; mammaglobin 2 , MGB2; mammaglobin-B; lacryglobin; lipophilin C; LPHC; mammaglobin B; MGC71973; UGB3; lipophilin-C; mammaglobin 2; mammaglobin-2; MGB2; |
| Gene ID | 4246 |
| mRNA Refseq | NM_002407 |
| Protein Refseq | NP_002398 |
| MIM | 604398 |
| UniProt ID | O75556 |
| ◆ Recombinant Proteins | ||
| SCGB2A1-250H | Recombinant Human SCGB2A1 Protein, MBP/His-tagged | +Inquiry |
| SCGB2A1-949H | Recombinant Human SCGB2A1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| SCGB2A1-950H | Recombinant Human SCGB2A1 Protein, Myc/DDK-tagged | +Inquiry |
| SCGB2A1-29236TH | Recombinant Full Length Human SCGB2A1 Protein, GST-tagged | +Inquiry |
| SCGB2A1-1262HFL | Recombinant Full Length Human SCGB2A1 Protein, C-Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SCGB2A1-2037HCL | Recombinant Human SCGB2A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SCGB2A1 Products
Required fields are marked with *
My Review for All SCGB2A1 Products
Required fields are marked with *
