Recombinant Full Length Human SCP2 Protein
Cat.No. : | SCP2-459HF |
Product Overview : | Recombinant full length Human Sterol carrier protein 2, isoform 2 with N-terminal proprietary tag. Predicted MW 41.84 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 143 amino acids |
Description : | This gene encodes two proteins: sterol carrier protein X (SCPx) and sterol carrier protein 2 (SCP2), as a result of transcription initiation from 2 independently regulated promoters. The transcript initiated from the proximal promoter encodes the longer SCPx protein, and the transcript initiated from the distal promoter encodes the shorter SCP2 protein, with the 2 proteins sharing a common C-terminus. Evidence suggests that the SCPx protein is a peroxisome-associated thiolase that is involved in the oxidation of branched chain fatty acids, while the SCP2 protein is thought to be an intracellular lipid transfer protein. This gene is highly expressed in organs involved in lipid metabolism, and may play a role in Zellweger syndrome, in which cells are deficient in peroxisomes and have impaired bile acid synthesis. Alternative splicing of this gene produces multiple transcript variants, some encoding different isoforms. |
Form : | Liquid |
Molecular Mass : | 41.840kDa inclusive of tags |
AA Sequence : | MGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKL EEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGS VLPNSDKKADCTITMADSDFLALMTGKMNPQSAFFQGKLK ITGNMGLAMKLQNLQLQPGNAKL |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | SCP2 sterol carrier protein 2 [ Homo sapiens ] |
Official Symbol | SCP2 |
Synonyms | SCP2; sterol carrier protein 2; non-specific lipid-transfer protein |
Gene ID | 6342 |
mRNA Refseq | NM_001007098 |
Protein Refseq | NP_001007099 |
MIM | 184755 |
UniProt ID | P22307 |
◆ Recombinant Proteins | ||
SCP2-31466TH | Recombinant Human SCP2 | +Inquiry |
SCP2-4934R | Recombinant Rat SCP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SCP2-2542H | Recombinant Human SCP2, GST-tagged | +Inquiry |
SCP2-3711H | Recombinant Human SCP2 protein, His-tagged | +Inquiry |
SCP2-1239H | Recombinant Human SCP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
SCP2-2023HCL | Recombinant Human SCP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SCP2 Products
Required fields are marked with *
My Review for All SCP2 Products
Required fields are marked with *
0
Inquiry Basket