Recombinant Full Length Human SDHC Protein, GST tagged
Cat.No. : | SDHC-10HFL |
Product Overview : | Human SDHC full-length ORF (1 a.a. - 169 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat germ cell free in vitro. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat germ cell free in vitro |
Tag : | GST |
Protein Length : | 1-169 aa |
Description : | This gene encodes one of four nuclear-encoded subunits that comprise succinate dehydrogenase, also known as mitochondrial complex II, a key enzyme complex of the tricarboxylic acid cycle and aerobic respiratory chains of mitochondria. The encoded protein is one of two integral membrane proteins that anchor other subunits of the complex, which form the catalytic core, to the inner mitochondrial membrane. Several related pseudogenes are located in different genomic regions. Mutations in this gene have been associated with paragangliomas. Alternatively spliced transcript variants encoding different isoforms have been described. |
Molecular Mass : | 44.33 kDa |
AASequence : | MAALLLRHVGRHCLRAHFSPQLCIRNAVPLGTTAKEEMERFWNKNIGSNRPLSPHITIYSWSLPMAMSICHRGTGIALSAGVSLFGMSALLLPGNFESYLELVKSLCLGPALIHTAKFALVFPLMYHTWNGIRHLMWDLGKGLKIPQLYQSGVVVLVLTVLSSMGLAAM |
Quality Control Testing : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Application : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Note : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | SDHC succinate dehydrogenase complex, subunit C, integral membrane protein, 15kDa [ Homo sapiens (human) ] |
Official Symbol | SDHC |
Synonyms | SDHC; succinate dehydrogenase complex, subunit C, integral membrane protein, 15kDa; PGL3, succinate dehydrogenase complex, subunit C, integral membrane protein, 15kD; succinate dehydrogenase cytochrome b560 subunit, mitochondrial; QPs-1; integral membrane protein CII-3; integral membrane protein CII-3b; cytochrome B large subunit of complex II; succinate dehydrogenase complex subunit C; succinate-ubiquinone oxidoreductase cytochrome B large subunit; succinate-ubiquinone oxidoreducatase cytochrome B large subunit; CYBL; PGL3; QPS1; SDH3; CYB560; |
Gene ID | 6391 |
mRNA Refseq | NM_001035511 |
Protein Refseq | NP_001030588 |
MIM | 602413 |
UniProt ID | Q99643 |
◆ Native Proteins | ||
SDHC-10HFL | Recombinant Full Length Human SDHC Protein, GST tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SDHC Products
Required fields are marked with *
My Review for All SDHC Products
Required fields are marked with *