Recombinant Full Length Human SDHD Protein

Cat.No. : SDHD-458HF
Product Overview : Recombinant full length Human SDHD with a N terminal proprietary tag: predicted MW 43.56 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 159 amino acids
Description : Complex II of the respiratory chain, which is specifically involved in the oxidation of succinate, carries electrons from FADH to CoQ.The complex is composed of four nuclear-encoded subunits and is localized in the mitochondrial inner membrane.The subunit D protein is one of two integral membrane proteins anchoring the complex to the matrix side of the membrane.Mutations in SDHD have been linked to hereditary paraganglioma.
Form : Liquid
Molecular Mass : 43.560kDa inclusive of tags
AA Sequence : MAVLWRLSAVCGALGGRALLLRTPVVRPAHISAFLQDRPI PEWCGVQHIHLSPSHHSGSKAASLHWTSERVVSVLLLGLL PAAYLNPCSAMDYSLAAALTLHGHWGLGQVVTDYVHGDAL QKAAKAGLLALSALTFAGLCYFNYHDVGICKAVAMLWKL
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name SDHD succinate dehydrogenase complex, subunit D, integral membrane protein [ Homo sapiens ]
Official Symbol SDHD
Synonyms SDHD; succinate dehydrogenase complex, subunit D, integral membrane protein; PGL, PGL1; succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial
Gene ID 6392
mRNA Refseq NM_003002
Protein Refseq NP_002993
MIM 602690
UniProt ID O14521

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SDHD Products

Required fields are marked with *

My Review for All SDHD Products

Required fields are marked with *

0

Inquiry Basket

cartIcon