Recombinant Full Length Human SDHD Protein
| Cat.No. : | SDHD-458HF |
| Product Overview : | Recombinant full length Human SDHD with a N terminal proprietary tag: predicted MW 43.56 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 159 amino acids |
| Description : | Complex II of the respiratory chain, which is specifically involved in the oxidation of succinate, carries electrons from FADH to CoQ.The complex is composed of four nuclear-encoded subunits and is localized in the mitochondrial inner membrane.The subunit D protein is one of two integral membrane proteins anchoring the complex to the matrix side of the membrane.Mutations in SDHD have been linked to hereditary paraganglioma. |
| Form : | Liquid |
| Molecular Mass : | 43.560kDa inclusive of tags |
| AA Sequence : | MAVLWRLSAVCGALGGRALLLRTPVVRPAHISAFLQDRPI PEWCGVQHIHLSPSHHSGSKAASLHWTSERVVSVLLLGLL PAAYLNPCSAMDYSLAAALTLHGHWGLGQVVTDYVHGDAL QKAAKAGLLALSALTFAGLCYFNYHDVGICKAVAMLWKL |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | SDHD succinate dehydrogenase complex, subunit D, integral membrane protein [ Homo sapiens ] |
| Official Symbol | SDHD |
| Synonyms | SDHD; succinate dehydrogenase complex, subunit D, integral membrane protein; PGL, PGL1; succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial |
| Gene ID | 6392 |
| mRNA Refseq | NM_003002 |
| Protein Refseq | NP_002993 |
| MIM | 602690 |
| UniProt ID | O14521 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SDHD Products
Required fields are marked with *
My Review for All SDHD Products
Required fields are marked with *
Recently Viewed
