Recombinant Full Length Rickettsia Typhi Succinate Dehydrogenase Hydrophobic Membrane Anchor Subunit(Sdhd) Protein, His-Tagged
| Cat.No. : | RFL30805RF |
| Product Overview : | Recombinant Full Length Rickettsia typhi Succinate dehydrogenase hydrophobic membrane anchor subunit(sdhD) Protein (Q68XP0) (1-125aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rickettsia typhi |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-125) |
| Form : | Lyophilized powder |
| AA Sequence : | MIYDFKAEIIKSKSSSSSKSGAHHWLLQRVTGVVLALCSFWLIYFMFTNKNNDINIIMWE FKKPFNIVILLITVTISLYHSVLGMRVVIEDYINCHKLRNTLIIIVKLFCILTIVAFIVA IFYSE |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | sdhD |
| Synonyms | sdhD; RT0116; Succinate dehydrogenase hydrophobic membrane anchor subunit |
| UniProt ID | Q68XP0 |
| ◆ Recombinant Proteins | ||
| SDHD-4952R | Recombinant Rat SDHD Protein, His (Fc)-Avi-tagged | +Inquiry |
| SDHD-1466C | Recombinant Chicken SDHD | +Inquiry |
| RFL30805RF | Recombinant Full Length Rickettsia Typhi Succinate Dehydrogenase Hydrophobic Membrane Anchor Subunit(Sdhd) Protein, His-Tagged | +Inquiry |
| SDHD-14806M | Recombinant Mouse SDHD Protein | +Inquiry |
| Sdhd-1761M | Recombinant Mouse Sdhd protein, His & T7-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SDHD-2008HCL | Recombinant Human SDHD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All sdhD Products
Required fields are marked with *
My Review for All sdhD Products
Required fields are marked with *



