Recombinant Full Length Human SDR42E1 Protein, GST-tagged

Cat.No. : SDR42E1-3973HF
Product Overview : Human HSPC105 full-length ORF ( NP_660151.1, 1 a.a. - 383 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 383 amino acids
Description : SDR42E1 (Short Chain Dehydrogenase/Reductase Family 42E, Member 1) is a Protein Coding gene. GO annotations related to this gene include oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor and 3-beta-hydroxy-delta5-steroid dehydrogenase activity. An important paralog of this gene is SDR42E2.
Molecular Mass : 69.6 kDa
AA Sequence : MDPKRSQKESVLITGGSGYFGFRLGCALNQNGVHVILFDISSPAQTIPEGIKFIQGDIRHLSDVEKAFQDADVTCVFHIASYGMSGREQLNRNLIKEVNVRGTDNILQVCQRRRVPRLVYTSTFNVIFGGQVIRNGDESLPYLPLHLHPDHYSRTKSIAEQKVLEANATPLDRGDGVLRTCALRPAGIYGPGEQRHLPRIVSYIEKGLFKFVYGDPRSLVEFVHVDNLVQAHILASEALRADKGHIASGQPYFISDGRPVNNFEFFRPLVEGLGYTFPSTRLPLTLVYCFAFLTEMVHFILGRLYNFQPFLTRTEVYKTGVTHYFSLEKAKKELGYKAQPFDLQEAVEWFKAHGHGRSSGSRDSECFVWDGLLVFLLIIAVLM
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name SDR42E1 short chain dehydrogenase/reductase family 42E, member 1 [ Homo sapiens ]
Official Symbol SDR42E1
Synonyms HSPC105
Gene ID 93517
mRNA Refseq NM_145168
Protein Refseq NP_660151
UniProt ID Q8WUS8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SDR42E1 Products

Required fields are marked with *

My Review for All SDR42E1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon