Recombinant Full Length Human SEC11C Protein, C-Flag-tagged

• Cat.No.: SEC11C-2069HFL
• Product Overview: Recombinant Full Length Human SEC11C Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: Predicted to enable peptidase activity. Predicted to be involved in signal peptide processing. Predicted to be located in endoplasmic reticulum membrane. Predicted to be part of signal peptidase complex.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 21.4 kDa
• AA Sequence: MVRAGAVGAHLPASGLDIFGDLKKMNKRQLYYQVLNFAMIVSSALMIWKGLIVLTGSESPIVVVLSGSME PAFHRGDLLFLTNFREDPIRAGEIVVFKVEGRDIPIVHRVIKVHEKDNGDIKFLTKGDNNEVDDRGLYKE GQNWLEKKDVVGRARGFLPYVGMVTIIMNDYPKFKYALLAVMGAYVLLKRES myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Protease, Transmembrane
• Protein Pathways: Protein export
• Full Length: Full L.

Gene Information

• Gene Name: SEC11C SEC11 homolog C, signal peptidase complex subunit [ Homo sapiens (human) ]
• Official Symbol: SEC11C
• Synonyms: SPC21; SPCS4C; SEC11L3
• Gene ID: 90701
• mRNA Refseq: NM_033280.4
• Protein Refseq: NP_150596.1
• UniProt ID: Q9BY50