Recombinant Full Length Human SEC11C Protein, C-Flag-tagged

Cat.No. : SEC11C-2069HFL
Product Overview : Recombinant Full Length Human SEC11C Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : Predicted to enable peptidase activity. Predicted to be involved in signal peptide processing. Predicted to be located in endoplasmic reticulum membrane. Predicted to be part of signal peptidase complex.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 21.4 kDa
AA Sequence : MVRAGAVGAHLPASGLDIFGDLKKMNKRQLYYQVLNFAMIVSSALMIWKGLIVLTGSESPIVVVLSGSME PAFHRGDLLFLTNFREDPIRAGEIVVFKVEGRDIPIVHRVIKVHEKDNGDIKFLTKGDNNEVDDRGLYKE GQNWLEKKDVVGRARGFLPYVGMVTIIMNDYPKFKYALLAVMGAYVLLKRES myc-FLAG tag
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Protease, Transmembrane
Protein Pathways : Protein export
Full Length : Full L.
Gene Name SEC11C SEC11 homolog C, signal peptidase complex subunit [ Homo sapiens (human) ]
Official Symbol SEC11C
Synonyms SPC21; SPCS4C; SEC11L3
Gene ID 90701
mRNA Refseq NM_033280.4
Protein Refseq NP_150596.1
UniProt ID Q9BY50

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SEC11C Products

Required fields are marked with *

My Review for All SEC11C Products

Required fields are marked with *

0
cart-icon