Recombinant Full Length Human SEC11C Protein, C-Flag-tagged
| Cat.No. : | SEC11C-2069HFL |
| Product Overview : | Recombinant Full Length Human SEC11C Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | Predicted to enable peptidase activity. Predicted to be involved in signal peptide processing. Predicted to be located in endoplasmic reticulum membrane. Predicted to be part of signal peptidase complex. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 21.4 kDa |
| AA Sequence : | MVRAGAVGAHLPASGLDIFGDLKKMNKRQLYYQVLNFAMIVSSALMIWKGLIVLTGSESPIVVVLSGSME PAFHRGDLLFLTNFREDPIRAGEIVVFKVEGRDIPIVHRVIKVHEKDNGDIKFLTKGDNNEVDDRGLYKE GQNWLEKKDVVGRARGFLPYVGMVTIIMNDYPKFKYALLAVMGAYVLLKRES myc-FLAG tag |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Protease, Transmembrane |
| Protein Pathways : | Protein export |
| Full Length : | Full L. |
| Gene Name | SEC11C SEC11 homolog C, signal peptidase complex subunit [ Homo sapiens (human) ] |
| Official Symbol | SEC11C |
| Synonyms | SPC21; SPCS4C; SEC11L3 |
| Gene ID | 90701 |
| mRNA Refseq | NM_033280.4 |
| Protein Refseq | NP_150596.1 |
| UniProt ID | Q9BY50 |
| ◆ Recombinant Proteins | ||
| SEC11C-2559H | Recombinant Human SEC11C, GST-tagged | +Inquiry |
| SEC11C-1965H | Recombinant Human SEC11C Protein, His (Fc)-Avi-tagged | +Inquiry |
| SEC11C-4725H | Recombinant Human SEC11C Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| SEC11C-4832H | Recombinant Human SEC11C protein, His-SUMO-tagged | +Inquiry |
| SEC11C-5297R | Recombinant Rat SEC11C Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SEC11C-2001HCL | Recombinant Human SEC11C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SEC11C Products
Required fields are marked with *
My Review for All SEC11C Products
Required fields are marked with *



