Recombinant Full Length Human SERPINB8 Protein
| Cat.No. : | SERPINB8-465HF |
| Product Overview : | Recombinant full length Human SerpinB8 with a N terminal proprietary tag: predicted MW 52.73 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 242 amino acids |
| Description : | The superfamily of high molecular weight serine proteinase inhibitors (serpins) regulate a diverse set of intracellular and extracellular processes such as complement activation, fibrinolysis, coagulation, cellular differentiation, tumor suppression, apoptosis, and cell migration. |
| Form : | Liquid |
| Molecular Mass : | 52.730kDa inclusive of tags |
| AA Sequence : | MDDLCEANGTFAISLFKILGEEDNSRNVFFSPMSISSALA MVFMGAKGSTAAQMSQALCLYKDGDIHRGFQSLLSEVNRT GTQYLLRTANRLFGEKTCDFLPDFKEYCQKFYQAELEELS FAEDTEECRKHINDWVAEKTEGKISEVLDAGTVDPLTKLV LVNAIYFKGKWNEQFDRKYTRGMLFKTNEEKKTVQMMFKE AKFKMGYADEVHTQVLELPYVEEELSMVILLPDDNTDLAV KE |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | SERPINB8 serpin peptidase inhibitor, clade B (ovalbumin), member 8 [ Homo sapiens ] |
| Official Symbol | SERPINB8 |
| Synonyms | SERPINB8; serpin peptidase inhibitor, clade B (ovalbumin), member 8; PI8, serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 8; serpin B8; CAP2; cytoplasmic antiproteinase 2 |
| Gene ID | 5271 |
| mRNA Refseq | NM_001031848 |
| Protein Refseq | NP_001027018 |
| MIM | 601697 |
| UniProt ID | P50452 |
| ◆ Recombinant Proteins | ||
| SERPINB8-465HF | Recombinant Full Length Human SERPINB8 Protein | +Inquiry |
| SERPINB8-1005H | Recombinant Human SERPINB8 Protein, MYC/DDK-tagged | +Inquiry |
| SERPINB8-31160TH | Recombinant Human SERPINB8 | +Inquiry |
| SERPINB8-2597H | Recombinant Human SERPINB8 protein, GST-tagged | +Inquiry |
| SERPINB8-2250H | Recombinant Human SERPINB8 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SERPINB8-665MCL | Recombinant Mouse SERPINB8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SERPINB8 Products
Required fields are marked with *
My Review for All SERPINB8 Products
Required fields are marked with *
