Recombinant Full Length Human SERPINE2 Protein, C-Flag-tagged
Cat.No. : | SERPINE2-1219HFL |
Product Overview : | Recombinant Full Length Human SERPINE2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the serpin family of proteins, a group of proteins that inhibit serine proteases. Thrombin, urokinase, plasmin and trypsin are among the proteases that this family member can inhibit. This gene is a susceptibility gene for chronic obstructive pulmonary disease and for emphysema. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 41.8 kDa |
AA Sequence : | MNWHLPLFLLASVTLPSICSHFNPLSLEELGSNTGIQVFNQIVKSRPHDNIVISPHGIASVLGMLQLGAD GRTKKQLAMVMRYGVNGVGKILKKINKAIVSKKNKDIVTVANAVFVKNASEIEVPFVTRNKDVFQCEVRN VNFEDPASACDSINAWVKNETRDMIDNLLSPDLIDGVLTRLVLVNAVYFKGLWKSRFQPENTKKRTFVAA DGKSYQVPMLAQLSVFRCGSTSAPNDLWYNFIELPYHGESISMLIALPTESSTPLSAIIPHISTKTIDSW MSIMVPKRVQVILPKFTAVAQTDLKEPLKVLGITDMFDSSKANFAKITTGSENLHVSHILQKAKIEVSED GTKASAATTAILIARSSPPWFIVDRPFLFFIRHNPTGAVLFMGQINKPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein |
Full Length : | Full L. |
Gene Name | SERPINE2 serpin family E member 2 [ Homo sapiens (human) ] |
Official Symbol | SERPINE2 |
Synonyms | GDN; PI7; PN1; PNI; PI-7; PN-1; GDNPF |
Gene ID | 5270 |
mRNA Refseq | NM_006216.4 |
Protein Refseq | NP_006207.1 |
MIM | 177010 |
UniProt ID | P07093 |
◆ Recombinant Proteins | ||
SERPINE2-1981H | Recombinant Human SERPINE2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SERPINE2-8057M | Recombinant Mouse SERPINE2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SERPINE2-8004H | Recombinant Human SERPINE2 protein, His & T7-tagged | +Inquiry |
SERPINE2-4350H | Recombinant Human SERPINE2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SERPINE2 -93R | Recombinant Rabbit PAI-1 stable mutant | +Inquiry |
◆ Cell & Tissue Lysates | ||
SERPINE2-1937HCL | Recombinant Human SERPINE2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SERPINE2 Products
Required fields are marked with *
My Review for All SERPINE2 Products
Required fields are marked with *
0
Inquiry Basket