Recombinant Full Length Human SETD9 Protein, GST-tagged

Cat.No. : SETD9-3847HF
Product Overview : Human C5orf35 full-length ORF ( NP_714917.1, 1 a.a. - 299 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 299 amino acids
Description : SETD9 (SET Domain Containing 9) is a Protein Coding gene. Among its related pathways are Regulation of TP53 Activity and Gene Expression. GO annotations related to this gene include methyltransferase activity.
Molecular Mass : 60.6 kDa
AA Sequence : MPGRLLRGLWQRWRRYKYRFVPWIALNLSHNPRTLRYVPEESKDKVISDEDVLGTLLKVFQALFLNDFNKQSEILTMLPESVKSKYQDLLAVEHQGVKLRENRHQQQSTFKPEEILYKTLGFSVAQATSSLISAGKGVFVTKGLVPKGAVVSMYPGTVYQKYEPIFFQSIGNPFIFRCLDGVLIDGNDKGISKVVYRSCNGRDRLGPLKMSDSTWLTSEIHNPLAVGQYVNNCSNDRAANVCYQEFDVPAVFPIELKQYLPNIAYSYDKQSPLRCVVLVALRDINQGEELFSNYYTIVS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name SETD9 SET domain containing 9 [ Homo sapiens (human) ]
Official Symbol SETD9
Synonyms C5orf35; SETD9; SET domain containing 9; SET domain-containing protein 9
Gene ID 133383
mRNA Refseq NM_001171990
Protein Refseq NP_001165461
UniProt ID Q8NE22

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SETD9 Products

Required fields are marked with *

My Review for All SETD9 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon