Recombinant Full Length Human SETD9 Protein, GST-tagged

• Cat.No.: SETD9-3847HF
• Product Overview: Human C5orf35 full-length ORF ( NP_714917.1, 1 a.a. - 299 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 299 amino acids
• Description: SETD9 (SET Domain Containing 9) is a Protein Coding gene. Among its related pathways are Regulation of TP53 Activity and Gene Expression. GO annotations related to this gene include methyltransferase activity.
• Molecular Mass: 60.6 kDa
• AA Sequence: MPGRLLRGLWQRWRRYKYRFVPWIALNLSHNPRTLRYVPEESKDKVISDEDVLGTLLKVFQALFLNDFNKQSEILTMLPESVKSKYQDLLAVEHQGVKLRENRHQQQSTFKPEEILYKTLGFSVAQATSSLISAGKGVFVTKGLVPKGAVVSMYPGTVYQKYEPIFFQSIGNPFIFRCLDGVLIDGNDKGISKVVYRSCNGRDRLGPLKMSDSTWLTSEIHNPLAVGQYVNNCSNDRAANVCYQEFDVPAVFPIELKQYLPNIAYSYDKQSPLRCVVLVALRDINQGEELFSNYYTIVS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: SETD9 SET domain containing 9 [ Homo sapiens (human) ]
• Official Symbol: SETD9
• Synonyms: C5orf35; SETD9; SET domain containing 9; SET domain-containing protein 9
• Gene ID: 133383
• mRNA Refseq: NM_001171990
• Protein Refseq: NP_001165461
• UniProt ID: Q8NE22