Recombinant Full Length Human SGSH Protein, C-Flag-tagged
Cat.No. : | SGSH-965HFL |
Product Overview : | Recombinant Full Length Human SGSH Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes the enzyme sulfamidase; one of several enzymes involved in the lysosomal degradation of heparan sulfate. Mutations in this gene are associated with the lysosomal storage disease mucopolysaccaridosis IIIA, also known as Sanfilippo syndrome A, which results from impaired degradation of heparan sulfate. Transcripts of varying sizes have been reported but their biological validity has not been determined. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 54.6 kDa |
AA Sequence : | MSCPVPACCALLLVLGLCRARPRNALLLLADDGGFESGAYNNSAIATPHLDALARRSLLFRNAFTSVSSC SPSRASLLTGLPQHQNGMYGLHQDVHHFNSFDKVRSLPLLLSQAGVRTGIIGKKHVGPETVYPFDFAYTE ENGSVLQVGRNITRIKLLVRKFLQTQDDRPFFLYVAFHDPHRCGHSQPQYGTFCEKFGNGESGMGRIPDW TPQAYDPLDVLVPYFVPNTPAARADLAAQYTTVGRMDQGVGLVLQELRDAGVLNDTLVIFTSDNGIPFPS GRTNLYWPGTAEPLLVSSPEHPKRWGQVSEAYVSLLDLTPTILDWFSIPYPSYAIFGSKTIHLTGRSLLP ALEAEPLWATVFGSQSHHEVTMSYPMRSVQHRHFRLVHNLNFKMPFPIDQDFYVSPTFQDLLNRTTAGQP TGWYKDLRHYYYRARWELYDRSRDPHETQNLATDPRFAQLLEMLRDQLAKWQWETHDPWVCAPDGVLEEK LSPQCQPLHNELTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Glycosaminoglycan degradation, Lysosome, Metabolic pathways |
Full Length : | Full L. |
Gene Name | SGSH N-sulfoglucosamine sulfohydrolase [ Homo sapiens (human) ] |
Official Symbol | SGSH |
Synonyms | HSS; SFMD; MPS3A |
Gene ID | 6448 |
mRNA Refseq | NM_000199.5 |
Protein Refseq | NP_000190.1 |
MIM | 605270 |
UniProt ID | P51688 |
◆ Recombinant Proteins | ||
SGSH-6275H | Recombinant Human SGSH Protein (Arg21-Leu502), C-His tagged | +Inquiry |
SGSH-2634H | Recombinant Human SGSH, His-tagged | +Inquiry |
SGSH-280H | Recombinant Human SGSH, GST-tagged | +Inquiry |
SGSH-474HF | Recombinant Full Length Human SGSH Protein, GST-tagged | +Inquiry |
SGSH-473HF | Recombinant Full Length Human SGSH Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SGSH-1884HCL | Recombinant Human SGSH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SGSH Products
Required fields are marked with *
My Review for All SGSH Products
Required fields are marked with *
0
Inquiry Basket