Recombinant Full Length Human Short-Chain Dehydrogenase/Reductase 3(Dhrs3) Protein, His-Tagged
| Cat.No. : | RFL29715HF |
| Product Overview : | Recombinant Full Length Human Short-chain dehydrogenase/reductase 3(DHRS3) Protein (O75911) (1-302aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-302) |
| Form : | Lyophilized powder |
| AA Sequence : | MVWKRLGALVMFPLQMIYLVVKAAVGLVLPAKLRDLSRENVLITGGGRGIGRQLAREFAE RGARKIVLWGRTEKCLKETTEEIRQMGTECHYFICDVGNREEVYQTAKAVREKVGDITIL VNNAAVVHGKSLMDSDDDALLKSQHINTLGQFWTTKAFLPRMLELQNGHIVCLNSVLALS AIPGAIDYCTSKASAFAFMESLTLGLLDCPGVSATTVLPFHTSTEMFQGMRVRFPNLFPP LKPETVARRTVEAVQLNQALLLLPWTMHALVILKSILPQAALEEIHKFSGTYTCMNTFKG RT |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | DHRS3 |
| Synonyms | DHRS3; RDH17; SDR16C1; UNQ2424/PRO4983; Short-chain dehydrogenase/reductase 3; DD83.1; Retinal short-chain dehydrogenase/reductase 1; retSDR1; Retinol dehydrogenase 17; Short chain dehydrogenase/reductase family 16C member 1 |
| UniProt ID | O75911 |
| ◆ Recombinant Proteins | ||
| RFL32596BF | Recombinant Full Length Bovine Short-Chain Dehydrogenase/Reductase 3(Dhrs3) Protein, His-Tagged | +Inquiry |
| DHRS3-1257R | Recombinant Rhesus monkey DHRS3 Protein, His-tagged | +Inquiry |
| DHRS3-5243C | Recombinant Chicken DHRS3 | +Inquiry |
| DHRS3-2718H | Recombinant Human DHRS3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| DHRS3-11975H | Recombinant Human DHRS3, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DHRS3-6937HCL | Recombinant Human DHRS3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DHRS3 Products
Required fields are marked with *
My Review for All DHRS3 Products
Required fields are marked with *



