Recombinant Full Length Human Signal Peptidase Complex Subunit 2(Spcs2) Protein, His-Tagged
Cat.No. : | RFL15993HF |
Product Overview : | Recombinant Full Length Human Signal peptidase complex subunit 2(SPCS2) Protein (Q15005) (2-226aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (2-226) |
Form : | Lyophilized powder |
AA Sequence : | AAAAVQGGRSGGSGGCSGAGGASNCGTGSGRSGLLDKWKIDDKPVKIDKWDGSAVKNSLD DSAKKVLLEKYKYVENFGLIDGRLTICTISCFFAIVALIWDYMHPFPESKPVLALCVISY FVMMGILTIYTSYKEKSIFLVAHRKDPTGMDPDDIWQLSSSLKRFDDKYTLKLTFISGRT KQQREAEFTKSIAKFFDHSGTLVMDAYEPEISRLHDSLAIERKIK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SPCS2 |
Synonyms | SPCS2; KIAA0102; SPC25; Signal peptidase complex subunit 2; Microsomal signal peptidase 25 kDa subunit; SPase 25 kDa subunit |
UniProt ID | Q15005 |
◆ Recombinant Proteins | ||
SPCS2-15853M | Recombinant Mouse SPCS2 Protein | +Inquiry |
SPCS2-4429R | Recombinant Rhesus monkey SPCS2 Protein, His-tagged | +Inquiry |
Spcs2-6086M | Recombinant Mouse Spcs2 Protein, Myc/DDK-tagged | +Inquiry |
SPCS2-2570H | Recombinant Human SPCS2 Protein, MYC/DDK-tagged | +Inquiry |
RFL6704CF | Recombinant Full Length Dog Signal Peptidase Complex Subunit 2(Spcs2) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPCS2-626HCL | Recombinant Human SPCS2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPCS2 Products
Required fields are marked with *
My Review for All SPCS2 Products
Required fields are marked with *
0
Inquiry Basket