Recombinant Full Length Human SLAMF7 Protein, C-Flag-tagged
Cat.No. : | SLAMF7-1326HFL |
Product Overview : | Recombinant Full Length Human SLAMF7 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables identical protein binding activity. Predicted to be involved in adaptive immune response. Predicted to act upstream of or within regulation of natural killer cell activation. Located in endoplasmic reticulum. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 37.2 kDa |
AA Sequence : | MAGSPTCLTLIYILWQLTGSAASGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTI IVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSN KNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPIL ARKLCEGAADDPDSSMVLLCLLLVPLLLSLFVLGLFLWFLKRERQEEYIEEKKRVDICRETPNICPHSGE NTEYDTIPHTNRTILKEDPANTVYSTVEIPKKMENPHSLLTMPDTPRLFAYENVITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Full Length : | Full L. |
Gene Name | SLAMF7 SLAM family member 7 [ Homo sapiens (human) ] |
Official Symbol | SLAMF7 |
Synonyms | 19A; CS1; CD319; CRACC |
Gene ID | 57823 |
mRNA Refseq | NM_021181.5 |
Protein Refseq | NP_067004.3 |
MIM | 606625 |
UniProt ID | Q9NQ25 |
◆ Recombinant Proteins | ||
SLAMF7-186HA | Recombinant Human SLAMF7 protein, Fc-tagged, APC labeled | +Inquiry |
SLAMF7-051H | Active Recombinant Human SLAMF7 protein, Fc/Avi-tagged, Biotinylated | +Inquiry |
SLAMF7-449H | Recombinant Full Length Human SLAMF7 Protein, Fc-tagged | +Inquiry |
SLAMF7-187H | Recombinant Human SLAMF7 protein, His-Avi-tagged, Biotinylated | +Inquiry |
SLAMF7-2499H | Recombinant Human SLAMF7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLAMF7-2378HCL | Recombinant Human SLAMF7 cell lysate | +Inquiry |
SLAMF7-2591MCL | Recombinant Mouse SLAMF7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLAMF7 Products
Required fields are marked with *
My Review for All SLAMF7 Products
Required fields are marked with *