Recombinant Full Length Human SLC1A4 Protein, C-Flag-tagged
Cat.No. : | SLC1A4-1704HFL |
Product Overview : | Recombinant Full Length Human SLC1A4 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a sodium-dependent neutral amino acid transporter for alanine, serine, cysteine, and threonine. Defects in this gene have been associated with developmental delay, microcephaly, and intellectual disability. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 55.5 kDa |
AA Sequence : | MEKSNETNGYLDSAQAGPAAGPGAPGTAAGRARRCAGFLRRQALVLLTVSGVLAGAGLGAALRGLSLSRT QVTYLAFPGEMLLRMLRMIILPLVVCSLVSGAASLDASCLGRLGGIAVAYFGLTTLSASALAVALAFIIK PGSGAQTLQSSDLGLEDSGPPPVPKETVDSFLDLARNLFPSNLVVAAFRTYATDYKVVTQNSSSGNVTHE KIPIGTEIEGMNILGLVLFALVLGVALKKLGSEGEDLIRFFNSLNEATMVLVSWIMWYVPVGIMFLVGSK IVEMKDIIVLVTSLGKYIFASILGHVIHGGIVLPLIYFVFTRKNPFRFLLGLLAPFATAFATCSSSATLP SMMKCIEENNGVDKRISRFILPIGATVNMDGAAIFQCVAAVFIAQLNNVELNAGQIFTILVTATASSVGA AGVPAGGVLTIAIILEAIGLPTHDLPLILAVDWIVDRTTTVVNVEGDALGAGILHHLNQKATKKGEQELA EVKVEAIPNCKSEEETSPLVTHQNPAGPVASAPELESKESVLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Full Length : | Full L. |
Gene Name | SLC1A4 solute carrier family 1 member 4 [ Homo sapiens (human) ] |
Official Symbol | SLC1A4 |
Synonyms | SATT; ASCT1; SPATCCM |
Gene ID | 6509 |
mRNA Refseq | NM_003038.5 |
Protein Refseq | NP_003029.2 |
MIM | 600229 |
UniProt ID | P43007 |
◆ Recombinant Proteins | ||
SLC1A4-15255M | Recombinant Mouse SLC1A4 Protein | +Inquiry |
SLC1A4-637Z | Recombinant Zebrafish SLC1A4 | +Inquiry |
SLC1A4-8251M | Recombinant Mouse SLC1A4 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC1A4-1704HFL | Recombinant Full Length Human SLC1A4 Protein, C-Flag-tagged | +Inquiry |
SLC1A4-094H | Recombinant Human solute carrier family 1 member 4 Protein, His&Flag&StrepII tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC1A4-1798HCL | Recombinant Human SLC1A4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLC1A4 Products
Required fields are marked with *
My Review for All SLC1A4 Products
Required fields are marked with *
0
Inquiry Basket